KEGG   Shewanella sediminis: Ssed_1538Help
Entry
Ssed_1538         CDS       T00596                                 

Definition
(GenBank) Cysteine--tRNA ligase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
sse  Shewanella sediminis
Pathway
sse00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sse00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Ssed_1538
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sse01007]
    Ssed_1538
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sse03016]
    Ssed_1538
Enzymes [BR:sse01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     Ssed_1538
Amino acid related enzymes [BR:sse01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Ssed_1538
Transfer RNA biogenesis [BR:sse03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Ssed_1538
 Prokaryotic Type
    Ssed_1538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ABV36149
UniProt: A8FTH6
Position
1835163..1836542
Genome map
AA seq 459 aa AA seqDB search
MLKLYNSLTRQKEEFKPLQPGKVGMYVCGITIYDLCHIGHGRTFVSFDMIVRYLRYSGYD
VNFLRNITDVDDKIIKRANENKESCESLTERLIGEMHRDFDALNMKRPDFEPRATLHIPE
IIDMVEKLIEKEHAYVSGNGDVLFSVSSFPEYGRLSGQNLDQLQAGARVEVEDTKRDPMD
FVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSKHLGQHFDIHGGGSDLQFPHHENEIA
QSCCAHNTPYVNYWMHTGMVMVDKEKMSKSLNNFFTIRDVLEHYDAATVRYFLLSGHYRS
QLNYSEDNLKQAKSALERLYTSLKGLDLSVEAASADEYVAKFKVAMDDDFNTPEAYSVLF
EMVREINRLKEADNAKASSLGVKLKELADVLGILDQDVDTFFKGEGSTDEVAEIEALIAE
RNRARAEKDWPAADVARDGLNALGVILEDGPEGTTWRKK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagctatacaacagtctgacccgccaaaaagaggaattcaaaccattacagcca
ggaaaagttggcatgtatgtgtgtgggataaccatctatgacctttgtcatatcggtcac
ggtcgtacttttgtctctttcgacatgatagtgagatacctgcgttactccggatatgat
gtgaactttctacgcaacattaccgatgttgacgacaagatcattaagcgtgctaatgaa
aataaagagagctgtgagtcattgaccgaacggttaattggcgagatgcatcgtgatttt
gatgcgcttaatatgaagcgtcccgactttgaaccaagagcgacgctacatatacctgag
attatcgatatggttgaaaaacttatcgagaaagaacatgcctatgtgtcaggtaatggt
gatgtactgttcagtgtctcctcttttcctgaatatggacgtctgtccggacaaaaccta
gaccagttacaagccggtgcccgagtcgaagtggaagacactaaacgtgatccaatggat
ttcgtgctgtggaagatgtccaagcctggcgagcctacatgggagtcaccttggggaccg
ggccgccctggctggcacattgaatgttcagcaatgaactctaagcacttgggtcaacat
ttcgatatccatggtggcggctcagatcttcaatttcctcaccatgagaatgaaattgct
cagtcttgctgtgctcacaacacgccgtacgtaaattactggatgcataccggtatggtg
atggtcgataaagagaagatgtctaagtcgttaaacaacttcttcaccatcagagatgtt
ttagagcactatgatgcggcaaccgtgaggtatttcctgttgtctggtcattaccgcagc
caactgaactactcagaagacaatcttaagcaggcaaagtcggcgcttgagcgtctctat
acatcactcaaaggtttagacctgtcggttgaagctgcatctgccgatgagtatgtcgct
aagtttaaggtcgcaatggatgatgacttcaatacgccggaagcttactcggtgctattt
gagatggttcgagagataaaccgtctaaaagaagctgataatgctaaagcatcttcactc
ggtgtaaaacttaaagagcttgccgatgtattaggtatattggaccaggatgtcgacact
ttctttaagggtgaaggcagtacagatgaagtggcggagatcgaagccctgattgccgag
cgtaacagagcgagagccgagaaggattggcccgctgccgatgttgcccgtgatggcttg
aacgcactcggtgttatcttagaagatggcccggaaggtacaacctggcgtaagaagtaa

DBGET integrated database retrieval system