KEGG   Shewanella sediminis: Ssed_1539Help
Entry
Ssed_1539         CDS       T00596                                 

Definition
(GenBank) Methylenetetrahydrofolate dehydrogenase (NADP(+))
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
sse  Shewanella sediminis
Pathway
sse00670  One carbon pool by folate
sse01100  Metabolic pathways
sse01120  Microbial metabolism in diverse environments
sse01200  Carbon metabolism
Module
sse_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:sse00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Ssed_1539
Enzymes [BR:sse01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     Ssed_1539
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     Ssed_1539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ABV36150
UniProt: A8FTH7
Position
complement(1836651..1837505)
Genome map
AA seq 284 aa AA seqDB search
MTAQRIDGKAIAQSIRTQLKEKVTARKEAGQRVPGLAVILVGADPASQVYVGSKRRACEE
VGFLSRSYDLDTTTSEAELLTLIDECNEDPAIDGILVQLPLPEHIEESKVIERIRPDKDV
DGFHPYNVGRLAQRIPVLRSCTPMGIMTLIKTTGIDTYGLDAVIVGASNIVGRPMSLELL
LAGCTTTTCHRFTRNLEQKVRQADLLVVAVGKPGFIPGEWIKPGAIVIDVGINRLEDGSL
AGDVQFDAASENASFITPVPGGVGPMTIASLLENTLYAAEQYHD
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgacagctcaaagaatcgatggaaaagcgatcgctcaatccattcgaacacagctaaaa
gaaaaagttaccgcccgcaaagaggcaggacagagggttcctggtttagccgtgattcta
gtcggtgcagatcccgcttcacaagtttatgtcggcagtaagcgacgcgcttgcgaagag
gtcgggtttttatcccgctcttatgatttagataccacgacatctgaagcagaactgctt
actcttatcgacgaatgcaacgaagacccggctatcgatggtatcttagttcagctgcct
cttccggaacatattgaagagtcgaaagtgatcgaacggatcagacccgataaagatgtc
gacggtttccacccctataatgtaggcagactcgctcagcgtatcccagtgcttcgctca
tgcacgccgatgggtatcatgactttgattaagacgacggggattgatacttatggttta
gatgctgtcatcgtgggtgcttcgaacatagtaggtcgccctatgagcctcgaactgctc
ctcgcagggtgtacgacaacaacgtgtcaccgtttcactcgaaatcttgaacagaaagtc
agacaggccgatctgctggttgtggccgtaggtaagccaggtttcattccaggagagtgg
attaaacctggcgctatcgtcatagatgtaggcatcaaccgcctcgaagatggcagttta
gccggtgatgtgcaatttgatgctgcatcagaaaatgccagtttcatcacccctgtccct
ggtggcgtaggaccaatgaccattgccagcctgctcgaaaataccctttatgcggctgag
cagtatcatgactga

DBGET integrated database retrieval system