KEGG   Shewanella sediminis: Ssed_2159Help
Entry
Ssed_2159         CDS       T00596                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
sse  Shewanella sediminis
Pathway
sse00860  Porphyrin and chlorophyll metabolism
sse01100  Metabolic pathways
Module
sse_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:sse00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ssed_2159
Enzymes [BR:sse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     Ssed_2159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABV36768
UniProt: A8FV95
Position
complement(2612336..2612977)
Genome map
AA seq 213 aa AA seqDB search
MKNDTQFTLLRHGLPEQSGCLLGRTNPPLTAKGWQQMDQSSDSLAFDIIISSPLVRCQAY
AQNLAQKHNSSLFIDAAWQELDFGHWDGDSIARLWEDPEQAYGQYWHAPFKHTPPNGEST
SDLLKRLTTSIDELSRKYRGQRLLIVCHSGVMRMVLAWLLCSTQESNPHLSRVQLEHAAL
LHFNTYIDEEDTLWPQLQGLINPSVSLNSLMDN
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgacacccaatttaccctgctgcgccatggactcccagagcaatcaggttgc
ctcctcggccgtaccaacccgccgctgacggctaaaggctggcagcagatggatcagagc
agtgactcactggcattcgacatcatcatcagctcgccgcttgtcaggtgtcaggcatac
gcccagaacctggcccaaaaacataacagcagccttttcatcgatgcggcctggcaagag
ctcgatttcggtcattgggatggcgacagcatcgccaggctatgggaagacccggagcaa
gcttacggccaatattggcacgccccctttaaacacacgccaccaaacggcgagtcaact
tcagatctattgaaacgactgacgacgagtatcgatgagctaagccgtaagtacagaggc
cagcgtctgttaatcgtctgtcattcaggagtgatgcggatggtcctggcatggcttctg
tgtagcactcaagagagcaacccacatctgagtcgggttcagctcgagcatgcggcgctg
ttgcatttcaacacctatatcgatgaagaagacaccctgtggccgcagcttcaaggctta
atcaatccgagcgtatctcttaactctttgatggataactaa

DBGET integrated database retrieval system