KEGG   Shewanella sediminis: Ssed_2349Help
Entry
Ssed_2349         CDS       T00596                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sse  Shewanella sediminis
Pathway
sse00010  Glycolysis / Gluconeogenesis
sse00071  Fatty acid degradation
sse00350  Tyrosine metabolism
sse00620  Pyruvate metabolism
sse00625  Chloroalkane and chloroalkene degradation
sse00626  Naphthalene degradation
sse00650  Butanoate metabolism
sse01100  Metabolic pathways
sse01110  Biosynthesis of secondary metabolites
sse01120  Microbial metabolism in diverse environments
sse01130  Biosynthesis of antibiotics
sse01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ssed_2349
   00620 Pyruvate metabolism
    Ssed_2349
   00650 Butanoate metabolism
    Ssed_2349
  Lipid metabolism
   00071 Fatty acid degradation
    Ssed_2349
  Amino acid metabolism
   00350 Tyrosine metabolism
    Ssed_2349
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Ssed_2349
   00626 Naphthalene degradation
    Ssed_2349
Enzymes [BR:sse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Ssed_2349
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Ssed_2349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 DUF1380
Motif
Other DBs
NCBI-ProteinID: ABV36958
UniProt: A8FVT5
Position
2856379..2858979
Genome map
AA seq 866 aa AA seqDB search
MTVTNEQELDLLVQRVADAQAEYANFSQEQVDKIFRAAALAAADARISLAKMAANETGMG
VIEDKVIKNHFASEYIYNKYKDEKTCGILDEDPTFGTITIAEPVGIICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKESTTTAARLVLNAAIEAGAPKDIIGWIDEPSVALSNQ
LMTHDKINLILATGGPGMVKAAYSSGKPAIGVGAGNTPIVIDETADIKRAVSSILMSKTF
DNGVVCASEQAVVIVDEIYDTVKERFATHGGYILSKDETAAMQNVILKNGGLNADIVGQS
AVTIAAMADIEVPSWTKVLIGEVEDVSEAEAFAHEKLSPLLGMYRVKDFEAAMDKAEALV
TLGGIGHTSGLYTNQDTQTERVMAFGFRMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPSHLINKKMVAKRAENMLWHKLPSSIYFRRGSLPIALEELSDKKRA
LIVTDKYLFNNGYCDETIKILKSQGLETEIFYEVEADPTLAIVTQGAKMAQSFQPDVIIA
LGGGSPMDAAKIIWVMYEHPDVDFADLALRFMDIRKRIYKFPKLGVKAQMVAIPTTSGTG
SEVTPFAVVTDEKTGMKYPIADYQLTPNMAIVDPNLVMDMPKSLTAFGGIDAVTHALEAY
VSVMANEYSDGQALQALDLLFKHLPDSYNHGAAAPIAREKVHNGATIAGIAFANAFLGIC
HSMAHKLGAEFHLAHGLANALLINNVIRFNATDMPTKQAAFSQYDRPKALCRYAKIAEYL
NLGGTTDEEKVEALIEEVDQLKKTIGIPASIREAGVNEADFLAKLDELAEDAFDDQCTGA
NPRYPLIEELKQVLLASFYGTAYSDK
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgacaaatgaacaagaactcgatcttcttgtacaacgtgtagcagatgctcag
gccgaatatgcaaatttcagtcaggagcaggtagataaaatatttcgagctgcggcactc
gccgctgcagatgccaggatctcattagccaagatggctgccaatgaaactggcatgggt
gtgattgaagataaagtgattaagaatcactttgcatctgaatacatctacaacaaatac
aaagatgagaagacatgtgggatattggatgaagatccgacattcggcaccattactata
gcggaacctgtcggcattatttgtggcatcgtgccaacgacaaacccgacttctaccgcc
attttcaaggcattgatcagcctcaagactcgtaacggcattattttctcacctcaccct
cgcgccaaagagtccacgactacagctgcaaggttagtattaaatgcagccatcgaagcc
ggcgcacctaaagatattatcggttggatcgacgagcctagtgttgccctctcaaatcag
ttgatgacccacgacaagattaacctgatcttggcaactggtggaccaggaatggttaaa
gcggcctactcttcaggaaagccggctatcggtgttggcgcaggtaacaccccaattgtc
atcgatgaaaccgcagatattaaacgtgctgtgagctcaatattgatgtctaaaacattc
gataacggcgtggtctgtgcctccgaacaagccgtcgtgattgtcgatgagatatacgat
accgttaaggaacgttttgctacacatggtggctatatcttatctaaagatgaaacagct
gcgatgcagaatgtcatcttaaaaaatggtggcctcaatgccgatatcgtcgggcaaagc
gctgtaaccatagccgccatggccgatatcgaagttccgagctggactaaggtattgatt
ggtgaagtggaagatgtttctgaagctgaagcatttgctcatgaaaaactatcgccattg
ttgggtatgtatcgagtcaaagacttcgaagctgccatggataaagccgaagctctggtt
acattgggtggtattggtcacacatcgggtctgtacaccaaccaagatacacaaactgag
cgcgtgatggcatttggtttccgcatgaagactgcgcgaatattgattaacactccagca
tcacaaggtggtattggcgatctttataactttaaactagcgccttcacttacactgggt
tgtggttcttggggaggtaactctatctctgaaaacgtgggtccaagtcacttaatcaat
aagaaaatggtcgctaagagggctgaaaatatgttgtggcacaagctaccgtcttcaatt
tacttccgtcgcggtagcctacctattgcactcgaagagttgagtgataagaaacgcgcc
cttatcgttacagataaatacctatttaataacggttactgtgatgagacgattaagatc
ctaaaatctcaaggcctcgagaccgaaatcttctacgaagtggaagccgatccaacctta
gcaattgtcactcaaggcgctaagatggctcagagcttccaacccgatgtgattatcgcg
cttggcggtggttctccaatggatgcagctaaaatcatctgggtgatgtatgagcatccc
gatgtagactttgccgacttggcattgcgcttcatggatattcgtaagcgtatctataaa
ttccctaaattgggtgttaaggcgcagatggttgccatccctacaacttcaggtacaggt
tcagaagtgacaccgtttgcggttgttaccgatgaaaaaaccggcatgaagtaccctatt
gccgattatcagctaacaccgaatatggcgattgtggatccgaaccttgtcatggacatg
ccaaaatcattaaccgcttttggtggcatcgatgcggtaacccatgctctggaagcctat
gtcagtgtgatggccaacgaatacagcgatggccaggcgcttcaggccttggatctacta
tttaagcaccttcctgattcttataaccacggtgcagcagcccctattgcacgtgagaaa
gtacacaacggtgcgaccattgcgggtatcgcctttgctaacgctttcttgggaatttgt
cactcgatggcccataagttaggcgccgagttccaccttgcacatggtttggccaatgca
ttattgattaacaatgtgatccgtttcaacgcaactgacatgccgactaaacaagcggcc
ttcagtcagtatgaccgtcctaaggcactttgtcgttacgcgaaaattgcagaatattta
aacctaggtggaacgaccgatgaagaaaaagttgaagcactcattgaagaggtcgatcaa
ctcaagaagacgattggcattccggcttcgatccgagaagcaggagtcaacgaagccgac
ttccttgcaaaactcgacgagctagctgaagatgcgttcgatgaccaatgtacaggggct
aacccaagatatccgctaatcgaagagcttaagcaggtactgcttgcaagtttctatggt
acagcttacagcgacaaataa

DBGET integrated database retrieval system