KEGG   Shewanella sediminis: Ssed_2653Help
Entry
Ssed_2653         CDS       T00596                                 

Definition
(GenBank) Methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sse  Shewanella sediminis
Pathway
sse00450  Selenocompound metabolism
sse00970  Aminoacyl-tRNA biosynthesis
sse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sse00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Ssed_2653
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Ssed_2653
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sse01007]
    Ssed_2653
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sse03016]
    Ssed_2653
Enzymes [BR:sse01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Ssed_2653
Amino acid related enzymes [BR:sse01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Ssed_2653
Transfer RNA biogenesis [BR:sse03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Ssed_2653
 Prokaryotic type
   Other AARSs
    Ssed_2653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 PhnA_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: ABV37260
UniProt: A8FWN7
Position
3207689..3209767
Genome map
AA seq 692 aa AA seqDB search
MANSQRKILVTSALPYANGPIHLGHMLEYIQTDIWSRFQKLRGHECHYICADDAHGTPIM
LKAQQLGIEPEEMIAQVNKEHQQDFADFNIKFDNFHSTHSVENRELSGEIYLKLRDAGFI
KTRTISQLFDPEKSMFLPDRFVKGTCPKCKSEDQYGDNCDNCGATYNPTDLIDPKSAVSG
ATPVMKDSEHFFFDLPAFENMLSEWTRSGAIQDEIANKLAEWFEQGLQQWDISRDAPYFG
FEIPDAPGKYFYVWLDAPIGYMGSFKNLCDRREDLNFDDFWSKDSTAEVYHFIGKDIVNF
HSLFWPAMLEGAGYRKPTSVFAHGYVTVNGAKMSKSKGTFIKARTYLDNLDPEYLRYYYA
AKLSNRIDDLDLNLEDFAQRVNSDLVGKLVNLASRTAGFISKRFDGKLAKIADTTLEETF
LAKQEVIADLYENREFGKAMREIMALADIANAYVADAAPWQLIKDEAKQDEAHQVCSNAL
NLFRILVTYLKPVLPKLADDVEAFLQFPLTWDNLGADLAGHEIAKFKALMQRIDMKNIEA
IIEASKDNLQATTEAAPEKKAKKSAETADVAVDTRSPLESDPISDEISFDDFAKLDLRIA
RIAKAEHVPEANKLLKLQLDLGGETKQVFAGIKSAYAPEDLEGKLTVMVANLAPRKMRFG
MSEGMVLAAGPGNKDLWILEPHEGAQPGMRVK
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggcaaattcacaacgtaaaatcctggtgacaagcgcacttccatacgccaatggacct
atccatttaggccatatgctggaatatattcaaaccgatatttggtcacgattccaaaaa
cttcgtggacatgaatgtcactatatctgtgccgatgatgcccatggtacgcctatcatg
cttaaggctcagcagctgggtattgagccggaagagatgatagctcaggtcaataaagag
catcagcaggattttgctgacttcaatatcaaatttgacaatttccacagcactcacagt
gttgaaaaccgcgaactttcgggtgaaatctacctcaagttacgtgatgccggttttatc
aagactcgcactatctcgcagttatttgatccagaaaagtcgatgtttcttccggaccgc
ttcgttaaaggcacctgccctaagtgtaagagtgaagatcagtacggcgataactgtgat
aactgtggcgccacatacaatcctacagatctgattgatcctaaatcggccgtatctggt
gcaactcctgtgatgaaggactctgagcatttcttcttcgacctgcctgcatttgaaaac
atgcttagcgagtggactcgctctggcgcaattcaagatgagatcgcaaataagctagct
gaatggttcgaacagggcctgcagcagtgggacatcagccgtgatgccccttacttcggc
ttcgagatccctgatgcgccgggtaagtacttttacgtatggctcgatgcccctatcggt
tacatgggttcgtttaaaaacctgtgtgacagacgtgaagatcttaacttcgacgacttc
tggtctaaagactctactgccgaggtgtatcacttcatcggtaaagatatcgttaacttc
cacagtttattctggccagccatgctcgaaggtgcgggttaccgtaaacccaccagtgta
ttcgctcacggctatgtcacggttaacggcgctaagatgtcaaagtctaaaggcaccttt
atcaaggcccgtacttaccttgataacttagatcctgaatacctgcgttattactatgcg
gctaagctcagcaatcgtattgacgatctcgaccttaacctggaagattttgcccagcgt
gttaactcagatctggttggtaagttagttaacctggcttcacgcaccgcgggctttatc
agcaagcgtttcgatggcaagttggctaaaatcgccgacaccacacttgaagagactttc
ctggcgaagcaggaggtcattgcagatctctacgagaaccgtgaattcggtaaggcgatg
cgtgagatcatggcactggctgatatcgccaacgcttatgttgccgacgctgcaccatgg
cagttaattaaagatgaggctaagcaagatgaggcacatcaggtgtgcagtaatgcacta
aacctgttccgcatcttagtgacttatctcaagccggtactgccaaaacttgcagacgat
gtcgaagccttccttcagttcccgcttacctgggacaatttaggcgccgatctcgccggt
catgaaattgctaagttcaaagccttgatgcaacgcatcgatatgaaaaatatcgaagct
atcatcgaagcgtcgaaggacaacttgcaagcaaccaccgaggctgcaccagagaagaaa
gctaagaaatcggctgaaacagctgatgtcgcagtagatacccgcagtccgctggaaagc
gaccctatctcagatgagataagcttcgatgatttcgccaaactcgacttgcgtattgca
cgtatcgctaaggccgaacatgtaccggaagccaataagctactgaaacttcagttagac
ttaggcggtgagaccaagcaggtctttgccggtatcaagtcagcttatgcgccggaagat
ctggaaggcaagctcaccgtgatggtggccaaccttgcgccgcgtaagatgcgcttcggt
atgtctgaaggcatggtgcttgctgcgggtcccggtaacaaagatctgtggatactggag
cctcacgaaggtgcccaaccgggtatgcgagttaagtaa

DBGET integrated database retrieval system