KEGG   Shewanella sediminis: Ssed_3846Help
Entry
Ssed_3846         CDS       T00596                                 

Definition
(GenBank) delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
sse  Shewanella sediminis
Pathway
sse00250  Alanine, aspartate and glutamate metabolism
sse00330  Arginine and proline metabolism
sse01100  Metabolic pathways
sse01110  Biosynthesis of secondary metabolites
sse01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sse00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ssed_3846
   00330 Arginine and proline metabolism
    Ssed_3846
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sse03000]
    Ssed_3846
Enzymes [BR:sse01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     Ssed_3846
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     Ssed_3846
Transcription factors [BR:sse03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    Ssed_3846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH H-kinase_dim MCRA
Motif
Other DBs
NCBI-ProteinID: ABV38450
UniProt: A8G027
Position
4687890..4691084
Genome map
AA seq 1064 aa AA seqDB search
MEAITMFKASEVLTGHYDQANLDELFTAITNNYIVDEDEYLSELIKLVPSSDDEIQRVTK
RAHDLVAKVRQYDKKGLMVGIDAFLQQYSLDTQEGIILMCLAEALLRIPDGATADALIQD
KLSGAKWDEHMSKSDSTLVNASTWGLMLTGKIVTLDKNIDGKPSNLLNRLVNRVGEPVIR
QAMLAAMKIMGKQFVLGTCIKDGLKNSEANRKIGYTHSYDMLGEAALTMVDADKYFSEYS
AAIAALGAQTYDESVAPRPTISIKLSALHPRYEVANEDRVLTELYDSLIKLIKKGRELNV
GIAIDAEEMDRLELHLKLFKKLYNSDAAKGWGLLGIVVQTYAKRGLPVLCWLTRLAKEQG
DEIPVRLVKGAYWDSELKWAQQAGEAGYSLFTRKAGTDVSYLASARYVLSDATRGAIYPE
FATHNAQSVAAIMDMAGDRRFEFQRLHGMGQELYDTLLAESPDTRIRIYAPIGEHKELLP
YLVRRLLENGANTSFVHKLVDPKVAIDSLVVHPIKTLQNYKTLSNNKIVQPADIFGEERK
NSKGLNMNIISESEPFFAALEKFKDTQWNVGPLVNGELLSGETKEVVSPFDTTKLVGKVA
FANNQAIEHALAGADNAFSSWCNTPVEVRATALQKLADLLEENREELIALCTREAGKSIQ
DGIDEVREAVDFCRYYAVQAKKMMAKPELLPGPTGELNELFLQGRGIFVCISPWNFPLAI
FLGQVAAALAAGNTVVAKPAEQTSIVGFRAVQLAHEAGIPKEALQFLPGTGATVGAAITS
DERINGVCFTGSTGTAKLINRTLANREGAIIPLIAETGGQNAMVVDSTSQPEQVVHDIID
SSFTSAGQRCSALRVLFLQEDIADRVLEVMKGAMDELTIGDPSSVKTDVGPVIDATAQAN
LNAHIDHIKQVGTLLKQLELPTGTKNGHFVAPTAVEIDSIKVLEKEHFGPILHVIRYKAA
DLHKVIDEINSTGFGLTLGIHSRNEGHALEVASKVKVGNVYINRNQIGAVVGVQPFGGQG
LSGTGPKAGGPHYLTRFITEKTRTNNITAIGGNATLLSLGDSEE
NT seq 3195 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgattactatgttcaaagcgagtgaagttctgactggtcactatgaccaagct
aatctcgatgagctatttacagccatcaccaataactacattgtcgatgaagatgaatat
ctatctgaacttatcaaactcgtaccttcgagtgacgatgaaatccagcgtgttaccaag
cgtgcccatgatttagtagctaaagttcgccaatatgacaagaaaggcctaatggttggc
atcgatgccttcctacagcagtacagcctggacacgcaggaaggtattatcctcatgtgt
ctggctgaagcattattacgaattccagacggcgcgacggccgatgcacttatccaggat
aaactttccggggctaagtgggatgagcatatgagtaagagtgattcgacgctcgtcaac
gcctcgacctggggcctgatgctgacaggaaaaatcgtcaccctggataaaaatatcgac
ggcaaacccagcaatcttctgaaccgtctggtcaaccgagtcggcgagcccgttatccgt
caggctatgctggcagccatgaaaataatgggtaaacagtttgttttaggtacctgcatc
aaagatggcctgaaaaacagtgaagcgaaccgaaagattggttatacccacagctacgat
atgctgggtgaagccgcgctgaccatggtcgatgcagacaaatatttcagtgaatattcg
gcagccatagccgcccttggcgcacaaacctatgatgagagtgtggcgccacgccccacc
atctccatcaagctctccgcattgcacccaaggtatgaagttgccaatgaagatcgcgtg
ctgaccgagctttatgactccttaatcaagctgattaagaaagggcgtgaactcaatgta
ggcatagcgatcgatgccgaagagatggacagactcgagctgcacctaaaacttttcaag
aaactctataactccgatgcagctaaaggctggggtcttttgggtatcgtagtacagacc
tatgctaaacgtggccttccggtactatgctggctgacacgccttgccaaagagcagggg
gatgagatcccggttcgcctcgtgaagggcgcctattgggacagcgagcttaaatgggca
cagcaagccggtgaagcgggctactcactctttaccaggaaggcgggaacggatgtctcc
taccttgcctcggccaggtacgtcctgtccgatgcgacccgcggcgccatctaccctgaa
tttgcgacccataatgcacaatcggtagccgccattatggacatggccggcgatcgccga
tttgaattccagcgtctgcacggcatggggcaggagctatacgatactctgctggccgaa
agcccggacacccgaatccgtatctacgcaccgattggtgagcacaaggagctactgcct
tatctggtacgtcgcctacttgaaaacggtgccaacacatcgtttgttcataaactggta
gaccctaaggtcgccatcgactcactggtggttcacccgataaagacacttcagaactat
aaaaccctatctaataataagatcgttcaacccgccgatatttttggggaagagcgtaaa
aactcaaagggactcaacatgaacatcatatctgaatcagagcctttcttcgctgcactc
gagaagtttaaagacactcagtggaacgtcgggcctttggtcaatggtgagcttttaagt
ggcgaaacgaaagaggtcgtcagcccgttcgataccaccaagctagtcggtaaagtcgcc
ttcgctaataatcaagccatagagcatgccttagcgggcgccgataacgccttctcgagc
tggtgcaatacaccggttgaagtgcgtgccacagcactacagaaactggccgatcttctc
gaggagaatcgtgaagagctgatcgcactctgtacccgagaggcgggtaagagcattcag
gacggtatagatgaggtccgtgaagcggtcgacttctgtcgttactatgccgtacaagct
aagaagatgatggctaagccggagctacttcctggcccgacaggcgagctcaacgagctg
ttcctgcaaggccgcggtatctttgtctgtatcagcccgtggaacttcccgctggccata
ttcttaggccaggtcgccgcggcgcttgctgccggtaacacggtagtggctaaacctgcc
gaacagacttctattgtcggtttccgcgccgttcaactcgctcatgaagcagggatcccg
aaagaggcacttcagttcctcccaggcacaggtgcgacagtcggtgccgctatcacttca
gatgagcgtatcaatggtgtctgtttcaccggctctacgggaacggccaagctgattaac
cgcactctggcaaaccgcgaaggcgcgatcatcccgcttatcgccgagacaggcggtcaa
aatgccatggttgtcgattcgacatctcagccagaacaggttgttcatgacattatcgac
tcatcatttaccagtgccggtcaacgttgctctgcgctgcgcgtactcttcctacaggaa
gatatcgcagacagagttctggaagtaatgaaaggcgccatggatgagctcacgattggc
gacccaagttcggtgaaaaccgatgtaggtccggtgatcgacgccacggcacaggctaac
cttaatgcccatatcgatcatatcaagcaagttggcaccctgcttaagcaactggagcta
cctacgggcaccaagaatggtcacttcgttgccccgactgccgtcgagatagattccatc
aaggtgttggagaaggagcatttcggcccaatcctgcacgtgatacgttacaaggccgcc
gatctgcataaggtgatcgatgagatcaacagcaccgggttcggtctgactcttggcata
cacagccgcaacgaaggccacgccctcgaagtggccagcaaggtcaaggtaggtaatgtc
tacatcaaccgtaatcagattggcgcagttgttggtgttcagccattcggtggacaaggc
ctgtctggcacgggtcctaaagccggtggtccacactacctgacgcgctttatcaccgag
aagactcgtaccaataacatcactgcgattggcgggaatgcaaccctactttcactgggt
gacagcgaagagtaa

DBGET integrated database retrieval system