KEGG   Shewanella sediminis: Ssed_4349
Entry
Ssed_4349         CDS       T00596                                 

Definition
(GenBank) general secretion pathway M protein
  KO
K02462  general secretion pathway protein M
Organism
sse  Shewanella sediminis
Pathway
sse03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sse00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Ssed_4349
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sse02044]
    Ssed_4349
Secretion system [BR:sse02044]
 Type II secretion system
  General secretion pathway protein
   Ssed_4349
SSDB
Motif
Pfam: T2SSM
Other DBs
NCBI-ProteinID: ABV38951
UniProt: A8G1H8
Position
complement(5326035..5326511)
AA seq 158 aa
MENLKAWWNGLILREQQLVGTCAVVLVIGIFYWGIWTPISNAEIDAERRLQAQESTLNFV
KQTANKIAGLKQSGTQSKFNGSLSAAVNLSAGAFGLEITRMQPQGNKIQLWMDDVPFDAL
LGYLNELVQEKGLSLDSIDLAESDVPGLVRVRRIQLSQ
NT seq 477 nt   +upstreamnt  +downstreamnt
atggagaaccttaaagcgtggtggaacggcctaatcttgcgagagcagcaactggtcgga
acttgtgctgtcgtgctggttatcggcatattttattgggggatctggactccgatatcg
aatgcagaaattgatgccgagcgtcgattgcaggcacaagagagcacattgaattttgtt
aagcaaaccgcaaataaaatcgcgggtttgaagcaaagcggtactcaatcaaagtttaac
ggtagtttaagtgccgccgttaacctgagtgcgggagcctttggattagagataacgcgt
atgcagcctcagggtaacaagatccagctatggatggacgatgtcccgttcgatgcgttg
cttggatatttgaatgaattggttcaggagaaagggttatcgttagatagcatagatctt
gctgaatcggatgtgcctggattagtccgtgttcgtcgtattcagctatcacaatga

DBGET integrated database retrieval system