KEGG   Shewanella sediminis: Ssed_4429Help
Entry
Ssed_4429         CDS       T00596                                 

Definition
(GenBank) protein of unknown function DUF890
  KO
K06970  23S rRNA (adenine1618-N6)-methyltransferase [EC:2.1.1.181]
Organism
sse  Shewanella sediminis
Brite
KEGG Orthology (KO) [BR:sse00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sse03009]
    Ssed_4429
Enzymes [BR:sse01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.181  23S rRNA (adenine1618-N6)-methyltransferase
     Ssed_4429
Ribosome biogenesis [BR:sse03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    Ssed_4429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_10 MTS Methyltransf_25 RP-C_C
Motif
Other DBs
NCBI-ProteinID: ABV39031
UniProt: A8G1Q8
Position
complement(5413578..5414792)
Genome map
AA seq 404 aa AA seqDB search
MTKHSQKQNRQKQTTQKQTRRKKPAGKLKAKSEAKLDTRGKPETTEKKGLHERNLHRDGY
DFEQLIEASPALKPYVRPNPYGNLSIDFADPLAVKALNLALLQLHYRIEYWDIPAGFLCP
PIPGRVDYLHYIADLLAGIDSDTVGDKAEEQVEEIGTRQNVPYASKPESSAPKQRYKSQK
RMKINALDIGTGANGIYPILGIQAYGWRFVASDVDPLSIENVNRIVGQNKALQGKLKTRL
QTDHQKVFHGIIQADDRFDITLCNPPFHASLSEASEGSLRKVKNLAANRAAKGHKPEPAA
SKAKPDANELNFGGQKAELWCEGGEKQFLANMIRESKDFATQCLWFTSLVSKKENLQPCY
AALEKVGAVTVKTIDMAQGNKLTRVLAWSYLTPKQQALWAKYRS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgactaagcactctcaaaaacagaaccgccagaaacagacaactcagaagcagacccga
cgaaaaaagccagcaggcaagctgaaagctaagtctgaagcaaagctcgatacaagaggc
aagcccgaaacgacagagaagaaaggcctccatgagcgaaacctgcatagggacggctat
gattttgaacagctgattgaggcatcaccggcgttaaaaccttatgtcagaccgaatcca
tacggtaacctttcgatagatttcgccgatcccttagccgttaaggcattgaacctggcc
ctgctgcaacttcactaccggattgagtattgggatatcccggcaggatttctctgtcct
ccgatccccggtcgggtcgattaccttcactatattgccgatctgttggccggaattgac
tcggacacggttggggataaagcagaggagcaggttgaggagatagggactagacaaaat
gtcccatacgcttctaaaccagaatcttcagcgcctaagcagaggtataagtctcagaaa
agaatgaagattaatgccctggatatcggtaccggtgccaatggcatctacccgatactc
ggcattcaagcctacggctggcggtttgtcgccagcgatgtagacccgctgtcgatagag
aacgttaatcggattgtcgggcaaaacaaggccttgcaaggcaagttaaagacacggctg
caaaccgatcatcaaaaagtgtttcatggcatcattcaagcagacgaccgattcgatatc
accctctgtaacccgccatttcacgcatcattgagtgaggcgagcgaaggtagccttcgt
aaggtgaagaacttagcggctaaccgagcggcgaaaggacataagcctgagcctgcagct
agtaaggctaaacctgatgccaatgagcttaacttcggtggccagaaggccgagctttgg
tgcgagggcggcgagaagcagtttctcgctaacatgatccgcgagagtaaagatttcgcc
actcaatgtttgtggttcaccagcctggtgtccaagaaagagaatctgcagccttgctac
gccgcactggaaaaggtgggggcggtgacggtgaagaccatagatatggcacaaggtaat
aagcttacacgggttttggcctggagttatctcacgcctaagcagcaggcgctctgggct
aagtatcgttcttag

DBGET integrated database retrieval system