KEGG   Streptococcus suis A7 (serotype 2): SSUA7_0412Help
Entry
SSUA7_0412        CDS       T02020                                 

Definition
(GenBank) galactose mutarotase-like protein
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
ssf  Streptococcus suis A7 (serotype 2)
Pathway
ssf00010  Glycolysis / Gluconeogenesis
ssf00052  Galactose metabolism
ssf01100  Metabolic pathways
ssf01110  Biosynthesis of secondary metabolites
ssf01120  Microbial metabolism in diverse environments
ssf01130  Biosynthesis of antibiotics
Module
ssf_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ssf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUA7_0412
   00052 Galactose metabolism
    SSUA7_0412
Enzymes [BR:ssf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SSUA7_0412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AER43742
Position
438602..439603
Genome map
AA seq 333 aa AA seqDB search
MIEVKTFDEKAKLYCLENKNGMQVTLTDFGARVVEVLLPVEENGGLRNVSLAAKSDDDYR
KTDLYPGSTIVPVAGRISGAQAEIEGTSYHFTENEPGRTLHGGVDTANEQYWDVELDHER
NQVTFGMVLKDGFNGFPGDVRVKAIYCLTDKNELTVDYQAVSDKDTIFNPTNHIYFNLTG
DFQRSVAEHRIKIAANHYAPLGEDNLPTGVLEDVTGTPFDFRDFAPFAQGFDSQYPQNVL
VKGYDHPWLLEEVDIPVEVLSPDGKIGLSVKTNQPAVVIYTYNFPVEALACYHGVFSLEC
QALPNACNVDGFGSILLEQGEEFLSKTTYRFTW
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgaagtaaaaacatttgatgaaaaagcaaaactgtattgcttggaaaacaagaat
gggatgcaggtaaccttgacggattttggtgccagagtggtggaagtgcttttgccagta
gaagaaaatggcggtctacggaatgtcagtttagctgccaagtcggatgatgattaccgt
aagacagatttgtaccctggttcaactattgtcccagtagcggggcgtatttcaggtgcc
caagctgagatagagggaacaagctaccatttcacagaaaatgaacctggtaggactcta
cacggtggggttgacacggcaaatgagcagtactgggacgttgagctagaccatgagaga
aatcaagtgacctttggtatggtcctaaaagatggttttaatggctttcctggtgatgtg
agggtcaaggctatttattgtttgacggataaaaatgaattgacagttgactaccaggct
gtatcggataaggatacgatttttaatccgaccaaccatatctatttcaacttgactggt
gattttcaacggtcagttgccgagcaccgtattaaaattgctgccaatcactatgctccg
cttggggaggataacctgccaacgggtgtcttagaagatgtgacagggacgccgtttgat
tttagagattttgcgccttttgctcagggatttgatagccaatatcctcaaaatgtgttg
gtaaaaggctatgaccacccatggttattggaagaggtggatattccggtagaagttttg
agtccagatgggaaaattggactcagtgtcaaaaccaaccagcctgcggtcgttatttat
acatataattttcctgttgaagctttggcctgttaccatggtgtctttagtttagagtgt
caggccttgccaaatgcatgcaatgtcgatggatttggttcgattttgttagaacaagga
gaagaatttttgtctaaaacgacctatcgttttacttggtaa

DBGET integrated database retrieval system