KEGG   Streptococcus suis A7 (serotype 2): SSUA7_0487Help
Entry
SSUA7_0487        CDS       T02020                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ssf  Streptococcus suis A7 (serotype 2)
Pathway
ssf00010  Glycolysis / Gluconeogenesis
ssf00051  Fructose and mannose metabolism
ssf00562  Inositol phosphate metabolism
ssf01100  Metabolic pathways
ssf01110  Biosynthesis of secondary metabolites
ssf01120  Microbial metabolism in diverse environments
ssf01130  Biosynthesis of antibiotics
ssf01200  Carbon metabolism
ssf01230  Biosynthesis of amino acids
Module
ssf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ssf_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ssf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUA7_0487 (tpiA)
   00051 Fructose and mannose metabolism
    SSUA7_0487 (tpiA)
   00562 Inositol phosphate metabolism
    SSUA7_0487 (tpiA)
Enzymes [BR:ssf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SSUA7_0487 (tpiA)
Exosome [BR:ssf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SSUA7_0487 (tpiA)
  Exosomal proteins of bladder cancer cells
   SSUA7_0487 (tpiA)
  Exosomal proteins of melanoma cells
   SSUA7_0487 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AER43815
Position
517120..517872
Genome map
AA seq 250 aa AA seqDB search
MSRKPIIAGNWKMNKNPQEAQAFVEAIAGKLPAGDKIEAAIAAPAVDLNALLWFAKDSEL
KVAAQNCYFEDAGAFTGETSPKVLAEMGVNYVVIGHSERRDYFHETDEDINKKAHAIFRN
GLTPIICCGESLETYEAGKAVEFVGAQVSAALKDLTADQVASLVIAYEPIWAIGTGKSAT
KDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVNPSNVAEYMACPDVDGALVGGASLE
AESFLALLNF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaatcattgccggtaactggaaaatgaacaaaaatcctcaagaagca
caagctttcgttgaggcaattgcaggaaaattgcctgcaggcgacaaaattgaagcagct
atcgcagctccagctgtagatttgaacgctctcttatggttcgctaaagattctgaattg
aaagttgctgctcaaaactgctactttgaagatgctggtgccttcactggtgaaacatct
ccaaaagtattggctgaaatgggtgttaactatgttgttatcggtcactcagagcgtcgt
gattacttccacgaaactgatgaagatattaataaaaaagctcatgcaatcttccgtaac
ggtttgactccaatcatctgttgtggtgagtcacttgaaacttacgaagctggtaaagca
gtagaatttgtaggtgctcaagtttctgcagctttgaaagacttgactgctgatcaagta
gcatcacttgttattgcttatgagccaatctgggcaatcggtactggtaaatcagctact
aaagatgatgcacaaaacatgtgtaaagctgttcgtgacgttgttgctgctgatttcggt
caagaagttgcagacaaagttcgcgttcaatacggtggttctgtaaacccatcaaacgtt
gctgaatacatggcatgtccagacgttgacggtgcgcttgttggtggtgcatcacttgaa
gcagaaagcttcttggctttgttgaacttctaa

DBGET integrated database retrieval system