KEGG   Selenomonas sputigena: Selsp_0904Help
Entry
Selsp_0904        CDS       T01474                                 

Definition
(GenBank) Glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
ssg  Selenomonas sputigena
Pathway
ssg00471  D-Glutamine and D-glutamate metabolism
ssg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Selsp_0904
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ssg01011]
    Selsp_0904
Enzymes [BR:ssg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     Selsp_0904
Peptidoglycan biosynthesis and degradation proteins [BR:ssg01011]
 Precursor biosynthesis
  Racemase
   Selsp_0904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AEB99868
UniProt: F4EZW1
Position
1013472..1014323
Genome map
AA seq 283 aa AA seqDB search
MRLIFRGKLIRICKRRILAYGKGALDDVKKEQPIGVFDSGLGGISVLRELVSLLPKEDFI
YFGDAAHAPYGERTEREIRALTTAQIDRMAAEGVKAVVLACNTATSAACAPLRRRYRQIP
IIGMEPALKPAILSGEKPRVVVMATHATLRQKKFARLMERFKDAGEIVKLPCPEIVEFVE
RGEIRSAALHEYLEERFLSVSQKPIDCVVLGCTHFPFVRDAIQDVVGQAVQIFDGAAGTA
RELKRRLLEADALRESGQKGAIEWLSSSSDPNYIERAKMLYEL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
ttgcggttgatttttcgcggcaaactcattagaatatgtaagaggcggattcttgcgtat
gggaaaggtgcattggacgacgtgaaaaaggagcagcccatcggtgtttttgattcagga
ctcggcggcatcagcgtgctgcgcgagctggtttcccttttgccgaaggaggatttcatt
tattttggcgatgctgcccatgcgccttatggcgagcgaacggagcgagagattcgcgcc
ttgacgacggcgcagatcgaccgcatggcggcagagggggtcaaagccgtcgtgcttgcc
tgcaatacggcgacgagtgccgcctgcgcccctttgcgccgaagatacagacagataccg
atcatcggcatggagccggcattgaagcctgcaatcttgagcggtgaaaagccgcgcgtc
gtcgtcatggcgacgcatgcgacgctcaggcagaagaagtttgcacgtctcatggagcga
ttcaaagatgcaggagagatcgtcaagctgccgtgtcctgagatcgtggaattcgtcgag
cgcggtgagattcgttcggcagcgctgcacgagtatctggaagagcggtttttgagcgta
tcacagaagcctatcgactgcgtcgtccttggctgcacgcattttccctttgtgcgcgat
gcgattcaagatgtcgtgggtcaggccgtgcagatttttgacggtgcggcgggtacggct
cgcgaactcaagcgtcgcctgttggaagccgatgctctgcgggaaagcgggcagaaaggc
gcgattgagtggctgagcagcagcagcgatccgaactatatcgagcgtgcaaagatgctc
tatgagttatga

DBGET integrated database retrieval system