KEGG   Selenomonas sputigena: Selsp_1298Help
Entry
Selsp_1298        CDS       T01474                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ssg  Selenomonas sputigena
Pathway
ssg00010  Glycolysis / Gluconeogenesis
ssg00030  Pentose phosphate pathway
ssg00051  Fructose and mannose metabolism
ssg00052  Galactose metabolism
ssg00680  Methane metabolism
ssg01100  Metabolic pathways
ssg01110  Biosynthesis of secondary metabolites
ssg01120  Microbial metabolism in diverse environments
ssg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ssg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Selsp_1298
   00030 Pentose phosphate pathway
    Selsp_1298
   00051 Fructose and mannose metabolism
    Selsp_1298
   00052 Galactose metabolism
    Selsp_1298
  Energy metabolism
   00680 Methane metabolism
    Selsp_1298
Enzymes [BR:ssg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Selsp_1298
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Selsp_1298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AEC00257
UniProt: C9LUB8
Position
complement(1466910..1468157)
Genome map
AA seq 415 aa AA seqDB search
MIGIKNVIAIICGGGPAPGINSVISAVTIEADRHGWDVLGIYDGFSRLARGEKKYVRLDM
ERVNRIHLTGGCILQMSRYNPTKKESDLRTVVDTLTELGVTHVVTIGGDDTAYSAMAVSN
YARQIGKTINVVHVPKTIDNDLPLPEGIPTFGFETARAFGTEEIENLMEDARTSNNRWYF
TIAMGRTAGHLALGMGRSAGAALTIIPEEFAAESIPLQQVVDIITGSIVKRYLTGHNYGV
AVIAEGVIEKIAPEDFQKLGNLVLDEHGHIRYAELDFGEILKQAVLAEVKKIGIKIAIVD
KEIGYELRCAAPIAYDIDYARSLGYEAVQFLMRGESGALITLQDNQAKPLFFDEIKDPET
GKTRVRKVNIESVHYKIARGFMMRMEKADLDDPGLANAYHMEKEEFKERYAYLFE
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgattggaatcaagaacgtcatcgccattatctgtggcggcgggcctgcgcccggcatc
aacagtgtcatttccgccgtgaccatcgaggccgaccgtcatggctgggatgtgctcggc
atttacgacggcttttcacgcctcgcacgcggcgagaagaagtatgtgcgcctcgacatg
gagcgagtgaaccgcatccacctgacggggggctgcatcctgcagatgtcgcgctacaat
ccgacgaagaaggagtccgatctgcgcacggtcgtcgataccctgacggaattgggcgtc
acgcatgtcgtgaccatcggcggcgacgacacggcgtacagcgccatggcggtgtcgaac
tatgcgcgccagatcggcaagacgatcaacgtcgtccatgtgccgaagaccatcgacaac
gatctgccgctgcccgaaggcattccgacatttggcttcgagacggcgcgtgcctttggc
acggaggaaatcgagaacctcatggaagacgcacgtacgagcaacaaccgctggtacttc
acgattgctatggggcgtacggcgggacacttggcgcttggcatggggcgttcggcaggg
gcagccttgacgatcatccccgaggagttcgcagcggaatccatccccttgcagcaggtt
gtcgacatcatcacaggatcgatcgtcaagcgttacttgacggggcacaactacggcgtc
gctgtcatcgccgaaggcgtcatcgagaagattgcaccggaggacttccagaagctcggc
aaccttgtgctcgacgagcatggccatatccgctatgcggagcttgacttcggtgagatc
ctgaagcaggcagtgctcgccgaggtcaagaagatcggcatcaagattgccatcgtggac
aaggaaattggctacgaattgcgctgtgccgcaccgattgcctacgacatcgattacgcg
cgctccctgggatacgaagctgtgcagttcctcatgcgcggcgagtcgggagcgctcatc
acgctgcaggacaatcaggcgaagccgctcttcttcgacgagatcaaggatcctgagacg
ggcaagacgagggtgcgcaaggtcaacatcgagtccgtccattacaagatcgcgcgcggc
tttatgatgcgcatggaaaaggcagacctcgacgatcccggccttgccaacgcctatcac
atggaaaaggaagaattcaaggagaggtacgcgtatctttttgaatga

DBGET integrated database retrieval system