KEGG   Selenomonas sputigena: Selsp_1437Help
Entry
Selsp_1437        CDS       T01474                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ssg  Selenomonas sputigena
Pathway
ssg00900  Terpenoid backbone biosynthesis
ssg01100  Metabolic pathways
ssg01110  Biosynthesis of secondary metabolites
ssg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ssg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Selsp_1437
Enzymes [BR:ssg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Selsp_1437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom Semialdhyde_dh NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEC00395
UniProt: C9LTW8
Position
complement(1593862..1595019)
Genome map
AA seq 385 aa AA seqDB search
MKNIAILGSTGSIGRQTVDVALAHPELFSVSVLAANASDELLEKQIEALSPELAVLADEA
AAARLKARYGGKTRIEGGRDAFIEAAAYPAADIVVTSMMGFAGLAPTMKALEAKKDIALA
NKETLVVAGELVMAKAREMGAAILPVDSEHSALFQCLQGEEARCVERIILTASGGPFRGK
TQDTLKKATVEECLAHPTWQMGQKITIDSATLVNKGLEVIEAHWLYDVSYDAIEVVVHPE
SIIHSMVGFTDGAVMAQIGPADMRLPIQYALTYPKRQSSSFERLDFSKLAHLSFEKPDTA
TFRGLPLAYEAGRAGGTMPCIMNAANEVAVAAFLAGKIRFLDIYAIIERTMEKCGVQKAP
TLDDLFAADDEARRVAQGFLQKIGG
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatattgcaatcttgggttctacgggttcgattggacgccagacggttgatgtg
gcgcttgcacatccggagctttttagtgtttccgtgctcgcagcgaacgcgagcgacgaa
ttgttggagaagcagatcgaagcgctctcccctgagcttgccgtgcttgccgacgaggcg
gcggcggcgaggctcaaggcgcggtacggcggcaagacgcgcatagaaggcggccgcgac
gccttcatcgaggcggcggcatatccggcggcggacatcgtcgtcacgagcatgatgggg
tttgcggggcttgcaccgacgatgaaggcgctcgaagcgaagaaggacatcgcgctagcg
aacaaggagacgctcgtcgtcgcgggcgaactcgtcatggcgaaggcgcgtgagatgggc
gcggcgatcctgcccgtcgacagcgagcactcggcgctctttcagtgcctgcagggcgag
gaggcgagatgcgtcgagcgcatcattctcacggcttcgggcggccccttccgaggaaag
acgcaggacacgctcaagaaggcgacggtcgaggagtgccttgcgcatccgacgtggcag
atggggcagaagatcacgatcgactctgctacgctcgtcaataaggggcttgaggtcatt
gaggcgcattggctctacgatgtgtcatacgatgcgatcgaggtcgtcgtccatcctgag
agcatcatccattcgatggttggctttacggatggcgccgtcatggcacagatcggaccg
gccgatatgcgcctgccgatccagtacgcgctgacgtatccgaagcgccagtcttcgtct
ttcgagcggctggacttttccaagctcgcgcatctttcttttgaaaagcccgacacggcg
acgtttcgcggacttcctctcgcctacgaggcggggcgtgcaggcggcacgatgccgtgc
atcatgaacgcagcgaacgaggtggccgtcgcggcatttctggcggggaaaatccgcttc
ctcgacatctatgcgatcatcgagcgcacgatggagaagtgcggcgtgcagaaggcgccg
acgctggacgatctctttgccgccgatgatgaagcgcggcgcgtggcgcagggcttcctg
cagaaaatagggggttga

DBGET integrated database retrieval system