KEGG   Selenomonas sputigena: Selsp_1622Help
Entry
Selsp_1622        CDS       T01474                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ssg  Selenomonas sputigena
Pathway
ssg00230  Purine metabolism
ssg01100  Metabolic pathways
Module
ssg_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ssg00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Selsp_1622
Enzymes [BR:ssg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Selsp_1622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 MMR_HSR1 Cytidylate_kin AAA_16 AAA_22 AAA_17 ABC_tran AAA AAA_29 Baseplate_J RsgA_GTPase ADK
Motif
Other DBs
NCBI-ProteinID: AEC00578
UniProt: C9LSX0
Position
complement(1790504..1791121)
Genome map
AA seq 205 aa AA seqDB search
MRKGLLVVVSGPSGAGKGTICQALLEKTPLAYSVSATTRKPRAGEVDGESYYFLSVEAFE
KMIEKDELLEWAKVYDNYYGTPLKKVEEKLAAGEDILLEIDTQGAMKVREKFPEGVYVFI
LPPSLAELERRIRGRDTETEDVLQKRLAAAIDEIEAGKCYKYVVTNDEVDGAVDSVCAIL
AAERRLVARNGELFDEIEKGREDPI
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaggacttttggtcgtcgtttccggcccgtcgggtgcgggcaagggcacgatc
tgtcaggcgctcttggaaaagacgccgcttgcctactccgtttccgctacgacgcgaaag
ccgcgtgcgggcgaggtcgacggcgagagctactatttcctctcggtcgaggcgttcgag
aaaatgatcgaaaaggacgaattgctcgaatgggcaaaggtctacgacaattattacgga
acgccattgaaaaaggtggaggaaaagctcgcggcgggcgaggatatcttgcttgagatc
gacacgcagggcgcgatgaaggtgcgcgagaagtttcctgagggcgtctacgtcttcatc
ttgccgccgtcgctcgccgagctggaaaggcgcatccgcgggcgcgacacggagacggag
gacgtcttgcagaagcgcctcgctgcggcgatcgatgagattgaagcgggaaagtgctac
aagtacgtcgtcacgaacgacgaggtcgatggcgcggtcgattccgtctgcgccatcctt
gcggcggagaggcgccttgtcgcacgcaatggagagctttttgacgaaatagaaaaggga
agggaagatccgatatga

DBGET integrated database retrieval system