KEGG   Selenomonas sputigena: Selsp_1749Help
Entry
Selsp_1749        CDS       T01474                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ssg  Selenomonas sputigena
Pathway
ssg00260  Glycine, serine and threonine metabolism
ssg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ssg01100  Metabolic pathways
ssg01110  Biosynthesis of secondary metabolites
ssg01130  Biosynthesis of antibiotics
ssg01230  Biosynthesis of amino acids
Module
ssg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ssg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Selsp_1749
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Selsp_1749
Enzymes [BR:ssg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Selsp_1749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PucR PcrB His_biosynth
Motif
Other DBs
NCBI-ProteinID: AEC00705
UniProt: C9LSI5
Position
complement(1918814..1919611)
Genome map
AA seq 265 aa AA seqDB search
MSTRLEHVLNGLKEKGRKGLIIYLTAGMPDAEGTIDAVRRAEEAGADIIELGLPFSDPMA
DGPVIQAASVAALKGGMTLAKVREIVQAIRRFSEMPLVGMGYVNNMLHYGFPRFVEDFKA
AGMDGVIIPDVPHEESGEMREICAAHDFPLMEFITPGTTPERMKETCASAAGFIYCVSNN
GVTGVKKVDYSQIGKIVKGARAYTKTPLAVGFGIGSPEAAVEAAAQADAVIVGSAVVKLL
LADRRDEAAELIAAMRKALDAAYHG
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcgtttggaacatgtattgaacggtctgaaagaaaagggtaggaaagggctc
atcatctatctgacggcgggcatgcccgatgcggaaggcacgatcgatgcggtgcgccgt
gcagaagaggcgggcgctgacatcatagagctcgggctgccgttttccgacccgatggcg
gacggtcccgtcatccaggcggcttccgtcgccgctttgaagggcggcatgacgctcgcg
aaagtgcgtgaaatcgtgcaggcgattcgccgtttctccgagatgccgctcgtgggcatg
ggctatgtcaacaacatgctgcactacggcttcccccgtttcgtcgaggatttcaaggcg
gcgggcatggacggcgtcatcatccccgatgtgccgcacgaggagtcgggtgaaatgcgc
gaaatttgcgcggcgcacgactttcccttgatggagttcatcacgccgggcacgacgccc
gagcgcatgaaggagacgtgcgcgagtgctgcaggcttcatctactgcgtgtccaacaac
ggcgtcacgggcgtcaagaaagtcgactacagccagatcggcaagatcgtcaagggtgcg
cgcgcctatacgaagacgccgctggcggtcggcttcggcatcggctcgcccgaggcggct
gtcgaagcggcggcacaagccgacgccgtcatcgtgggcagcgccgtcgtcaagctcctg
ctcgcggacaggcgggacgaggcggcggagttgatcgcggcgatgcgcaaagctctcgat
gcggcatatcatggctga

DBGET integrated database retrieval system