KEGG   Streptococcus suis P1/7 (serotype 2): SSU0407Help
Entry
SSU0407           CDS       T00936                                 

Definition
(GenBank) putative aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
ssi  Streptococcus suis P1/7 (serotype 2)
Pathway
ssi00010  Glycolysis / Gluconeogenesis
ssi00052  Galactose metabolism
ssi01100  Metabolic pathways
ssi01110  Biosynthesis of secondary metabolites
ssi01120  Microbial metabolism in diverse environments
ssi01130  Biosynthesis of antibiotics
Module
ssi_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ssi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSU0407
   00052 Galactose metabolism
    SSU0407
Enzymes [BR:ssi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SSU0407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CAR44936
Position
437248..438249
Genome map
AA seq 333 aa AA seqDB search
MIEVKTFDEKAKLYCLENKNGMQVTLTDFGARVVEVLLPVEENGGLRNVSLAAKSDDDYR
KTDLYPGSTIVPVAGRISGAQAEIEGTSYHFTENEPGRTLHGGVDTANEQYWDVELDHER
NQVTFGMVLKDGFNGFPGDVRVKAIYCLTDKNELTVDYQAVSDKDTIFNPTNHIYFNLTG
DFQRSVAEHRIKIAANHYAPLGEDNLPTGVLEDVTGTPFDFRDFAPFAQGFDSQYPQNVL
VKGYDHPWLLEEVDIPVEVLSPDGKIGLSVKTNQPAVVIYTYNFPVEALACYHGVFSLEC
QALPNACNVDGFGSILLEQGEEFLSKTTYRFTW
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgaagtaaaaacatttgatgaaaaagcaaaactgtattgcttggaaaacaagaat
gggatgcaggtaaccttgacggattttggtgccagagtggtggaagtgcttttgccagta
gaagaaaatggcggtctacggaatgtcagtttagctgccaagtcggatgatgattaccgt
aagacagatttgtaccctggttcaactattgtcccagtagcggggcgtatttcaggtgcc
caagctgagatagagggaacaagctaccatttcacagaaaatgaacctggtaggactcta
cacggtggggttgacacggcaaatgagcagtactgggacgttgagctagaccatgagaga
aatcaagtgacctttggtatggtcctaaaagatggttttaatggctttcctggtgatgtg
agggtcaaggctatttattgtttgacggataaaaatgaattgacagttgactaccaggct
gtatcggataaggatacgatttttaatccgaccaaccatatctatttcaacttgactggt
gattttcaacggtcagttgccgagcaccgtattaaaattgctgccaatcactatgctccg
cttggggaggataacctgccaacgggtgtcttagaagatgtgacagggacgccgtttgat
tttagagattttgcgccttttgctcagggatttgatagccaatatcctcaaaatgtgttg
gtaaaaggctatgaccacccatggttattggaagaggtggatattccggtagaagttttg
agtccagatgggaaaattggactcagtgtcaaaaccaaccagcctgcggtcgttatttat
acatataattttcctgttgaagctttggcctgttaccatggtgtctttagtttagagtgt
caggccttgccaaatgcatgcaatgtcgatggatttggttcgattttgttagaacaagga
gaagaatttttgtctaaaacgacctatcgttttacttggtaa

DBGET integrated database retrieval system