KEGG   Streptococcus suis P1/7 (serotype 2): SSU0582Help
Entry
SSU0582           CDS       T00936                                 

Gene name
arcB
Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
ssi  Streptococcus suis P1/7 (serotype 2)
Pathway
ssi00220  Arginine biosynthesis
ssi01100  Metabolic pathways
ssi01110  Biosynthesis of secondary metabolites
ssi01130  Biosynthesis of antibiotics
ssi01230  Biosynthesis of amino acids
Module
ssi_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:ssi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SSU0582 (arcB)
Enzymes [BR:ssi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     SSU0582 (arcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: CAR45285
Position
605457..606470
Genome map
AA seq 337 aa AA seqDB search
MTNVFKGRHFLAEKDFTRAELEWLIDFSAHLKDLKKRNIPHRYLEGKNIALLFEKTSTRT
RAAFTVASIDLGAHPEYLGANDIQLGKKESTEDTAKVLGRMFDGIEFRGFSQKMVEELAE
FSGVPVWNGLTDAWHPTQMLADYLTVKENFGKLEGLTLVYCGDGRNNVANSLLVTGAILG
VNVHIFSPKELFPEEEVVALAEGFAKESGARVLITDNADEAVKGADVLYTDVWVSMGEED
KFAERVALLKPYQVNMELVKKAENENLIFLHCLPAFHDTNTVYGKDVAEKFGVEEMEVTD
EVFRSKYARHFDQAENRMHTIKAVMAATLGDPFVPRV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacgtatttaaaggtagacatttccttgcagagaaagatttcacacgcgcagaa
ttggaatggttgattgatttctcagctcatttgaaagatttgaaaaaacgcaatattcca
caccgttatttggaaggtaaaaatattgctctcttgtttgaaaaaacatcaacacgtact
cgtgctgccttcacagtagcatctattgaccttggtgcccatccagaatatcttggtgca
aatgacatccaacttggtaagaaagaatctacagaagatactgctaaagttttgggacgt
atgttcgacggtattgaattccgtggtttcagtcaaaaaatggtggaagaattggcagaa
ttctccggtgtgccagtatggaatggtttgacagatgcatggcacccaactcaaatgttg
gcggactacttgactgtcaaagaaaactttggcaagttggaaggcttgactctggtttac
tgtggtgatggccgtaacaatgttgctaactcacttttggtaacaggcgctatccttggt
gtcaatgtccatatcttctctccaaaagaactcttcccagaagaagaagtagttgccttg
gctgaaggttttgcgaaagaaagtggagcacgtgttctcattactgacaatgctgacgaa
gcagtcaaaggcgcagatgttctctatacagacgtttgggtatcaatgggtgaagaagat
aaatttgctgaacgcgttgccctcttgaagccataccaagtgaatatggaattggtgaaa
aaagcagaaaatgaaaatctcatcttcttgcactgcttgcctgccttccatgatacaaac
actgtttatggtaaagatgtcgctgaaaaattcggcgtagaagaaatggaagtaacagac
gaagtattccgtagcaagtatgctcgtcacttcgaccaagctgaaaaccgtatgcacact
attaaagcagtgatggcggctactttaggggatccatttgttccacgtgtgtaa

DBGET integrated database retrieval system