KEGG   Streptococcus suis P1/7 (serotype 2): SSU0603Help
Entry
SSU0603           CDS       T00936                                 

Definition
(GenBank) putative glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ssi  Streptococcus suis P1/7 (serotype 2)
Pathway
ssi00480  Glutathione metabolism
ssi00590  Arachidonic acid metabolism
ssi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    SSU0603
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SSU0603
Enzymes [BR:ssi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SSU0603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: CAR45333
Position
629135..629614
Genome map
AA seq 159 aa AA seqDB search
MSIYDFTVQKQDGTDQSMAEYQGQVLLIVNTAPGCGLAPQYKELQELYDSYKDNGFVVLD
FPCNQFLNQAPGSAEDINQICSLNYGTTFPRFAKIAVNGSEASPLYRYLKKEKSTLLGGR
IEWNFTKFLVDRQGRVVKRYLPTTSPLKLKEDIELYLEK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttatgattttacagtacaaaaacaagatggcacagaccagtccatggctgag
tatcaaggacaagttttacttatagtcaatacagcgccaggttgtggattggcaccacaa
tacaaggaactacaggagctatatgatagctataaagacaacggttttgtagtgttggat
ttcccttgtaatcaatttttaaatcaggctcccggttctgcggaagacatcaatcagatc
tgtagcttgaattatggtacaacttttcctcgttttgctaaaattgctgtgaatggatct
gaagctagtccgctatatcgctatcttaagaaagaaaaatcaaccttattaggaggtcga
attgagtggaattttaccaagtttttggtggatagacaagggcgtgtggtcaaacgatat
ttaccaacaactagtccattaaaacttaaagaggatattgaactttacctagaaaaataa

DBGET integrated database retrieval system