KEGG   Streptococcus suis P1/7 (serotype 2): SSU0646Help
Entry
SSU0646           CDS       T00936                                 

Gene name
coaC
Definition
(GenBank) putative phosphopantothenoylcysteine decarboxylase
  KO
K01598  phosphopantothenoylcysteine decarboxylase [EC:4.1.1.36]
Organism
ssi  Streptococcus suis P1/7 (serotype 2)
Pathway
ssi00770  Pantothenate and CoA biosynthesis
ssi01100  Metabolic pathways
Module
ssi_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:ssi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SSU0646 (coaC)
Enzymes [BR:ssi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     SSU0646 (coaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: CAR45401
Position
complement(668276..668824)
Genome map
AA seq 182 aa AA seqDB search
MANITLAVTGSISAYKAADLTSQLTKIGHQVTVLMSRSAMDFITPLTLQSLSKNLVHTDV
MIEENPTLIKHIDIAKETDVFLVAPASANTIAKLANGMADNIITATALALPIGTKKLLAP
AMNTNMYLNPATQKNIKTLIEYGFEEIKPREALLACGDFGTGALAEVTDILEKVSNTLDE
KK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggctaatatcacacttgccgttactggctctatttcagcctacaaagcagcggaccta
actagtcaattgaccaagatcggtcatcaggttacagtcctcatgagtcgctctgctatg
gacttcatcacacctttgactctccaatccttgtcaaaaaatctggtccacacagatgtc
atgattgaagaaaatcctactcttatcaagcatatcgatattgccaaagaaacagacgta
tttttagttgcccctgcttctgccaatacgatagctaaattagctaatggtatggctgac
aacattattacggcaacagcgctggctctgccaattggtactaaaaaactgctggcacct
gctatgaatactaacatgtacctcaatcctgctacccagaaaaatatcaaaaccctcata
gagtatggttttgaggaaatcaaaccgcgtgaagccctgcttgcttgtggagattttgga
actggggccttggctgaggtaactgatattttagagaaagtgagtaacacccttgatgaa
aaaaaataa

DBGET integrated database retrieval system