KEGG   Streptococcus suis P1/7 (serotype 2): SSU1096Help
Entry
SSU1096           CDS       T00936                                 

Definition
(GenBank) putative N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
ssi  Streptococcus suis P1/7 (serotype 2)
Pathway
ssi00520  Amino sugar and nucleotide sugar metabolism
ssi01100  Metabolic pathways
ssi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ssi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SSU1096
Enzymes [BR:ssi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     SSU1096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: CAR46302
Position
complement(1111954..1113099)
Genome map
AA seq 381 aa AA seqDB search
MTVFIKAKSIILPESEVESAYLEITDKGQFGRIVIEKPEGEIVDYSDFHLAPGLVDTHIH
GYASHDVMDNDFEGIKVISEGLLSCGVTSWLPTTLTDTTENLDAVCETIGTYAGQETGAK
IQGIFLEGPFFTEKYKGAQNPKYMSDPSIEKLDNWHSLSKGLVNKIAIAPEREGVKEFIE
FANSKAIHTALAHSDATYAQAEAAVEAGANIFVHVYNGMSGLHHREPGMVGAALNLKNVY
AEMICDGHHVHPAAAEIVVKARGAEETVLITDCMRAGGMGEGESRLGEFEVVVKDGTARL
KESGSLAGSILELIEAVQNVVKWGLVSLPDALRMASLAPARSVNIDHICGRIAEGRAADF
IVVDDAGRLQATYLDGVKRFG
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgacagtatttataaaagcaaaatctattattttaccagagagtgaggtcgaatcagcc
tatttggaaattactgacaagggtcagtttggacggattgtgattgaaaagcctgaaggg
gagattgttgattattctgactttcatttagcaccagggctagttgatacacatatccac
ggctacgcttctcacgatgttatggacaatgattttgaagggatcaaggtaatttcagaa
ggtctcttgtcttgtggggtgacctcttggcttccaacgacattaacagatacgactgaa
aatttagatgcagtttgtgaaacgattgggacttatgcagggcaggaaacaggcgccaag
attcaaggtattttcttagaaggtcctttctttacagaaaaatacaagggagcacaaaat
cctaagtacatgagcgatccatccattgaaaagttagacaattggcacagcttatctaaa
ggtttagtcaataaaattgctattgctccagaacgtgaaggcgtcaaagaattcatcgag
tttgctaacagcaaggcaattcatactgccttggctcacagcgatgcgacctatgcgcaa
gcggaagcggcagtagaagctggtgccaatatcttcgtccatgtttacaatgggatgagt
gggcttcatcaccgtgaaccaggtatggtcggtgctgctttgaatttaaaaaatgtctat
gcggaaatgatttgtgatggacaccatgttcatccagctgcggcagaaatcgtggtcaaa
gcacgtggagctgaggaaactgttttgattacggactgtatgcgagctggcggtatgggt
gaaggggagtcccgcctcggtgaatttgaagttgttgtaaaagatggaactgctcgttta
aaagaaagtggtagtttggcaggttctatcttagaattgattgaagcagtgcagaatgtt
gtgaaatggggcttggtatccctacctgatgcccttcgtatggcttctctggcaccagct
cgctctgtcaatattgaccatatttgtggtcggattgcagaaggccgagctgcagacttt
atcgtcgtagatgatgcaggacgcttacaagcgacctatctagatggcgtgaaacgattt
ggttaa

DBGET integrated database retrieval system