KEGG   Streptococcus suis P1/7 (serotype 2): SSU1452Help
Entry
SSU1452           CDS       T00936                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ssi  Streptococcus suis P1/7 (serotype 2)
Pathway
ssi00071  Fatty acid degradation
ssi00072  Synthesis and degradation of ketone bodies
ssi00280  Valine, leucine and isoleucine degradation
ssi00362  Benzoate degradation
ssi00380  Tryptophan metabolism
ssi00620  Pyruvate metabolism
ssi00630  Glyoxylate and dicarboxylate metabolism
ssi00640  Propanoate metabolism
ssi00650  Butanoate metabolism
ssi00900  Terpenoid backbone biosynthesis
ssi01100  Metabolic pathways
ssi01110  Biosynthesis of secondary metabolites
ssi01120  Microbial metabolism in diverse environments
ssi01130  Biosynthesis of antibiotics
ssi01200  Carbon metabolism
ssi01212  Fatty acid metabolism
ssi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ssi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SSU1452 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    SSU1452 (atoB)
   00640 Propanoate metabolism
    SSU1452 (atoB)
   00650 Butanoate metabolism
    SSU1452 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SSU1452 (atoB)
   00072 Synthesis and degradation of ketone bodies
    SSU1452 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SSU1452 (atoB)
   00310 Lysine degradation
    SSU1452 (atoB)
   00380 Tryptophan metabolism
    SSU1452 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SSU1452 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SSU1452 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SSU1452 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssi04147]
    SSU1452 (atoB)
Enzymes [BR:ssi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SSU1452 (atoB)
Exosome [BR:ssi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSU1452 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FKBP_N
Motif
Other DBs
NCBI-ProteinID: CAR47016
Position
1465569..1466753
Genome map
AA seq 394 aa AA seqDB search
MKKVAIVSAYRSAIGSFGGSLKDIEIADLGAQVLETALASKNIPADSVDEVIFGNVLSAG
QGQNIARQIAIRAGIPQTASAYAVNKVCGSGLKSVLLAAQSIMLGDNDVVVAGGIEIMSQ
APYLSKTSRFGSKFGHITLEDSMLTDGLTDAFNDYHMGITAENVAEHYQVSRAEQDAFTY
SSQEKAAKAIAEGRFVDEIVPIRLKNRKGETIFATDEYPRLTPIEKLATLRPSFKKDGTV
TAANASGINDGCAVLILMSDEKASELNIQPLTYIEAYATSGLDPALMGLGPITASQKALQ
KLNKTVEDIDLFELNEAFAAQSIPVVKQLGIDPAKVNVNGGAIALGHPIGASGSRILVTL
IHELIKQEKELGLCSLCIGGGQGISLIVSNAQTS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagctatcgtgtctgcctatcgttctgccatcggcagtttcggaggtagt
ctgaaagatattgaaatcgctgatttaggggcgcaagtcctcgaaacagccttagctagt
aaaaacatccctgcagacagcgttgatgaagttatcttcggaaatgttctttcagcagga
caaggacaaaatattgcacgtcaaattgctattcgtgcaggcattcctcagacagcctct
gcctatgcagtcaataaagtctgtggttccggtctcaaatcagtcctcctggctgcccag
tcaatcatgctaggtgacaatgatgtagttgtggctggaggcattgaaattatgagccag
gcaccttatctatccaaaactagcaggtttggtagtaaatttggtcatattactctagaa
gattctatgctgacagacggtctaacagatgccttcaacgactatcacatgggcattact
gcagaaaatgttgctgaacactatcaagtcagtcgcgcagagcaagatgcttttacatac
agtagccaagagaaggctgcgaaagctattgctgagggaagatttgttgacgaaattgtt
cctattagattaaaaaatcggaaaggcgaaactatttttgccacagatgagtaccctcgt
ctgacgccaattgaaaaattggcaacacttcggccatcttttaaaaaggatggaaccgtc
accgcagccaatgcttctggcatcaacgacggctgtgctgtcttgatactcatgtctgat
gaaaaagccagtgagctaaatatccagccactcacctatattgaggcctatgcaacaagc
ggtttagatcccgcattgatggggcttggacctattactgctagccaaaaagcgctacaa
aaactgaataaaacagtcgaggatatcgatctattcgaactcaacgaggcatttgcagcc
caatcaattccagttgtcaaacaactcggcattgatcctgcaaaagtcaatgtcaatggt
ggtgctatcgcccttggacatccaatcggagctagtggtagtcgaatcctagtcactctg
attcacgaattaatcaagcaagaaaaagagcttggtctttgctcactttgtatcggaggc
ggtcaaggcatctccctaatcgtttccaatgcgcaaacaagttaa

DBGET integrated database retrieval system