KEGG   Streptococcus suis P1/7 (serotype 2): SSU1923Help
Entry
SSU1923           CDS       T00936                                 

Gene name
aspS
Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
ssi  Streptococcus suis P1/7 (serotype 2)
Pathway
ssi00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ssi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SSU1923 (aspS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ssi01007]
    SSU1923 (aspS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ssi03016]
    SSU1923 (aspS)
   03029 Mitochondrial biogenesis [BR:ssi03029]
    SSU1923 (aspS)
Enzymes [BR:ssi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     SSU1923 (aspS)
Amino acid related enzymes [BR:ssi01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   SSU1923 (aspS)
Transfer RNA biogenesis [BR:ssi03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SSU1923 (aspS)
 Prokaryotic Type
   Other AARSs
    SSU1923 (aspS)
Mitochondrial biogenesis [BR:ssi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SSU1923 (aspS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2b
Motif
Other DBs
NCBI-ProteinID: CAR47613
Position
complement(1956836..1958587)
Genome map
AA seq 583 aa AA seqDB search
MKRSMYAGRVRKEHVGQEITLKGWVGRRRGLGGLIFIDLRDREGIMQLVINPESVEAEVM
AKAESLRSEFVIEVTGTVVEREQANDNIPTGAVELQVTSLTVLNTAKTTPFEIKDGIEAS
DDTRLRYRYLDLRRPEMLNNFKLRAAVTHSIRNYLDDLEFIDVETPMLTKSTPEGARDYL
VPSRVSKGHFYALPQSPQITKQLLMNAGFDRYYQIVKCFRDEDLRGDRQPEFTQVDLETS
FLNEVEIQDIVEGLIAKVLKDTKGIDVTLPFPRMAYDHAMNFYGSDKPDTRFEMLLQDLT
ELVKEVDFKVFSEAPVVKAIVVKGAADSYSRKDIDKLTDYAKQFGAKGLAWVKVDKGELA
GPVAKFLTGITEKLTASLQLEDKDLVLFVADELEVANNTLGALRNRLAKEQGLIDESKFN
FLWIVDWPMFEWSEEEGRYMSAHHPFTLPTEETAHHLDGDLAQVRAVAYDIVLNGYELGG
GSLRINQKDMQEQMFKALGFSAEDAHEQFGFLLEAMDYGFPPHGGLAIGLDRFVMLLAGE
DNIREVIAFPKNNKASDPMTQAPSTVASAQLEELALDITLENE
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgttctatgtacgctggacgtgttcgtaaagaacatgtcggacaggaaattact
ttgaaaggttgggttggccgccgtcgtggcttgggtggcctgattttcattgacttgcgt
gaccgtgaaggcattatgcaattggtgattaaccctgagtcagttgaagctgaagtgatg
gcaaaagcggagagtcttcgttccgagtttgttatcgaagtaacaggaacggttgtggag
cgtgagcaagctaacgacaatatcccgacaggagctgttgaactgcaagtaaccagcttg
acagtgttgaacacggctaagacaactccgtttgaaatcaaggacggcattgaagccagt
gatgatacccgtcttcgttaccgttatttggatcttcgccgtccagaaatgctcaacaac
ttcaaattacgtgcggctgtaacccacagcattcgcaactacttggacgatttggaattt
atcgatgtggaaacaccaatgttgaccaagtcaacaccagaaggtgcgcgcgactacttg
gtaccatctcgtgtgtccaaaggtcatttctatgctttgccacaaagtccacagattact
aagcagcttttaatgaacgctggttttgaccgttactaccaaatcgttaagtgtttccgt
gatgaagatttgcgtggggatcgtcaacctgagtttacacaggttgacttggaaacctca
ttcttgaatgaggttgaaatccaagacatcgtagaaggcttgattgctaaggtcttgaaa
gataccaaaggaattgatgtgaccttgccattcccacgtatggcctatgaccatgcgatg
aacttctacggttcagataaaccagatactcgttttgagatgcttttgcaagacttgaca
gaacttgtcaaggaagttgacttcaaggtcttctcagaagcaccagttgtcaaagccatt
gtggtcaagggtgcggcggatagctactcacgtaaagacattgataaattaacagactac
gcaaaacaatttggtgctaagggacttgcttgggttaaagtagacaagggagaattagcg
ggcccagttgctaagttcttgacgggtattacagaaaaattgacagcaagtttacagttg
gaagacaaggatttggttctctttgtagcagatgaattggaagtagccaacaataccctg
ggagccttgcgtaaccgcttggcaaaagagcaaggcttgattgatgaaagcaagttcaac
ttcctctggattgtggattggccaatgtttgagtggtctgaagaggaaggtcgctatatg
agtgcccatcacccattcaccttgccgacggaagaaacagctcatcatttggatggtgat
ttggcgcaggtgcgtgcagttgcctacgatattgttttgaatggttatgaattgggtggc
ggtagccttcgtatcaaccaaaaagacatgcaagaacagatgttcaaggctcttggtttc
tcagctgaagatgcccatgagcagtttggtttcttgctagaagctatggactacggtttc
ccaccacacggtggattggctatcgggttggaccgctttgtcatgttattggctggtgag
gataacattcgtgaagttatcgcctttccgaagaataacaaggcatctgatccgatgaca
caggcaccaagtacggttgcatcagctcaattagaggaattggctttagacattacactt
gaaaatgaataa

DBGET integrated database retrieval system