KEGG   Streptomyces alfalfae: A7J05_03975Help
Entry
A7J05_03975       CDS       T05110                                 

Definition
(GenBank) ergothioneine biosynthesis protein EgtC
  KO
K07008  gamma-glutamyl hercynylcysteine S-oxide hydrolase [EC:3.5.1.118]
Organism
ssia  Streptomyces alfalfae
Pathway
ssia00340  Histidine metabolism
ssia01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssia00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    A7J05_03975
Enzymes [BR:ssia01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.118  gamma-glutamyl hercynylcysteine S-oxide hydrolase
     A7J05_03975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6 GATase_4
Motif
Other DBs
NCBI-ProteinID: APY85012
UniProt: A0A1P8TBK8
Position
1049399..1050154
Genome map
AA seq 251 aa AA seqDB search
MCRHLAFLGPPQPLGSLIVAPPHGLYRQSWAPRRQRHGTVNADGFGVGWYAEGDPEPARY
RRAGPIWADGSFADLARVVRSGALLAAVRDATEAGADGEAAAAPFAAGRWLFSHNGAVTG
WPRSLAPLSRGLPPDELLSMEARCDSALVWALVLNRLRRGDDEARALADTVREVAAAAPG
SRLNLLLTGGDTIAATAWGDTLWYLAEPGRRTVVASEPYDDDPHWREVPDRTLLAASRTD
VLLTPLKEPSA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtgccgccatctcgctttcctcggcccgccgcagccgctgggaagcctcatcgtcgcg
cccccgcacggcctgtaccggcagtcgtgggcgccccggcgccagcgccacggcaccgtc
aacgccgacggcttcggggtcggctggtacgccgaaggcgacccggagcccgcccgctac
cggcgcgcgggaccgatctgggccgacggctccttcgccgacctcgcccgggtcgtacgc
tccggggcgctcctcgccgcggtgcgcgacgccaccgaggcgggcgcggacggcgaggcc
gcggcggctcccttcgcggccggacgctggctgttcagtcacaacggcgcggtgacgggc
tggccgcgctcgctcgccccgctctcccggggcctgccgcccgacgaactgctctccatg
gaggcgcgctgcgactccgcgctggtgtgggccctcgtcctcaaccggctgcggcgcggc
gacgacgaggcgcgggcgctggccgacaccgtccgcgaggtcgccgcggcggccccgggc
tcccgcctcaacctcctgctcaccggcggcgacacgatcgccgcgaccgcctggggcgac
accctgtggtacctcgccgaaccaggacgccgcaccgtcgtcgcctccgagccctacgac
gacgacccccactggcgcgaggtgcccgaccgcaccctgctcgccgcgagccgcaccgac
gtactgctgacaccgctcaaggagccttccgcgtga

DBGET integrated database retrieval system