KEGG   Streptomyces alfalfae: A7J05_04095Help
Entry
A7J05_04095       CDS       T05110                                 

Definition
(GenBank) GntR family transcriptional regulator
  KO
K16423  (S)-3,5-dihydroxyphenylglycine transaminase [EC:2.6.1.103]
Organism
ssia  Streptomyces alfalfae
Pathway
ssia00261  Monobactam biosynthesis
ssia01055  Biosynthesis of vancomycin group antibiotics
ssia01100  Metabolic pathways
ssia01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ssia00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01055 Biosynthesis of vancomycin group antibiotics
    A7J05_04095
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    A7J05_04095
Enzymes [BR:ssia01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.103  (S)-3,5-dihydroxyphenylglycine transaminase
     A7J05_04095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_MocR DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: APY90595
UniProt: A0A1P8TSL5
Position
complement(1111835..1113205)
Genome map
AA seq 456 aa AA seqDB search
MPDRLPDRLPDRLPDRLPDRPPGRAARPLRKSELHASVSDPVLDTMTFLNEITSRYPEAI
SFAPGRPYDGFFDSEQIFGHLRRYLDHLAEQGSSPRQVRTAMYQYGPTAGQIREIIADSL
RADENIDVPAESIVVTVGAQEAMLLVLRALISGPDDVLLVSSPCYVGITGAARLLDVAVT
PVDERDDGFSCADLEAAIRSERARGRRPRAFYVVPDHSNPSGATLGPRARSELLELAGRH
GILVLEDSPYRLVSPGRRHPALKSMDQGHTVVHIGSFSKTVFPGARVGFVVADQPVVDDS
GRTGLLADELAKIKSMVTVNTSSLSQAAVAGALLAADGRVSELNTAAAAYYGDAMAATLR
ELDRHLPAKRRAALEVHWNEPTGGFFLTLRVPFRTDNAALIRSAQDFGVIWTPMSYFHPG
GGGPHGIRLSTSYLTPAQITEGTARLARFIEAQSGH
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
ctgccggaccgactgccggaccgactgccggaccgactgccggaccgactgccggaccga
ccgccgggccgggcggcgcggccgctgcgcaagagcgagctgcacgccagcgtgtccgac
ccggtcctggacacgatgacgttcctcaacgagatcacctcccgctaccccgaggcgatc
tccttcgcgcccggccgcccgtacgacggcttcttcgacagcgagcagatcttcggccac
ctgcgccgctacctggaccacctggcggagcagggcagttcaccgcgccaggtgcgcacc
gccatgtaccagtacgggcccaccgcggggcagatccgcgagatcattgccgactcgctg
cgggccgacgagaacatcgacgtacccgccgagtccatcgtggtgacggtcggcgcgcag
gaggcgatgctcctcgtgctgcgcgccctcatctccggccccgacgacgtcctgctcgtc
tccagcccctgctacgtgggcatcaccggcgccgcccgcctcctcgacgtcgcggtgacc
cccgtcgacgagcgggacgacgggttctcgtgcgccgacctcgaagcggcgatcaggagc
gagcgggcccgcgggcgccgcccccgcgccttctacgtcgtacccgaccactccaatccg
tcgggcgccaccctgggcccccgggcccgctccgaactcctcgaactcgcgggccgccac
ggcatcctcgtcctggaggacagcccctaccggctcgtcagcccggggcggcgccacccc
gccctgaagtcgatggaccaggggcacacggtcgtgcacatcggctcgttctccaagacg
gtgttccccggcgcccgggtgggcttcgtcgtcgccgaccagcccgtcgtggacgactcg
ggccgcaccggactcctcgcggacgaactcgcgaagatcaagagcatggtgacggtcaac
acctcgtcgctcagccaggccgccgtcgcgggcgcgctcctcgcggcggacgggcgcgtc
tcggagctgaacacggcggccgccgcctactacggcgacgccatggcggcgacgctcagg
gaactggaccggcacctgccggcaaagcggcgcgcggccctcgaagtgcactggaacgaa
cccaccggcggcttcttcctcaccctgcgcgtgccgttccgcacggacaacgcggcgctg
atcaggtcggcgcaggacttcggcgtcatctggacgccgatgtcgtacttccaccccggc
ggcggcggaccgcacggcatccgcctctccaccagctacctgacgcccgctcagatcacc
gagggcacggccaggctcgcccgcttcatcgaggcgcagagcgggcactga

DBGET integrated database retrieval system