KEGG   Streptomyces alfalfae: A7J05_06180
Entry
A7J05_06180       CDS       T05110                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ssia  Streptomyces alfalfae
Pathway
ssia03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ssia00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    A7J05_06180
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ssia03400]
    A7J05_06180
Enzymes [BR:ssia01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     A7J05_06180
DNA repair and recombination proteins [BR:ssia03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     A7J05_06180
SSDB
Motif
Pfam: DNA_primase_S
Other DBs
NCBI-ProteinID: APY85362
UniProt: A0A1P8TCL5
Position
complement(1601294..1602274)
AA seq 326 aa
MNDARTVRAGRHTVKLNRPEKVLFPAPDADRDGDGGASRAASGGRSGTGGEGHTKADLFD
HYRSVAPFMLPHLRGRPLMLERHPDGVTGPRFMQKDTPDHYPEWITRAEVAKQGGTVTHT
VCDDTATLLFLADQACVTLHRWLSRTGEIDHPDRLVFDLDPAKDDFAAVRDAARLLGGLL
DDIGLPYALMTTGSRGLHVVVPLNGRHDFDDVRGFAKDVADTLAAAHPNQLTTAARKEAR
GDRLYLDVQRNAYAQTAVAPFSVRAAPGAPVAMPIAREQLDDPAVHARHWTIDNALEQAR
SDPWADFPRTGRSLGPARRKLGALQG
NT seq 981 nt   +upstreamnt  +downstreamnt
atgaacgacgcacgaacggtgcgggccggccgccacaccgtgaagctgaaccgaccggag
aaggtcctgttccctgcgcccgacgcggacagggacggggacgggggcgcgtcccgggcc
gcgagcgggggccgctcgggaaccggcggcgagggtcacaccaaggcggacctgttcgac
cactaccggtccgtcgcccctttcatgctgccccacctgcgcggacgccccctgatgctg
gagcgtcacccggacggcgtaaccgggccgcgcttcatgcagaaggacaccccggaccac
taccccgagtggatcacgcgcgctgaggtcgcgaagcagggcggcaccgtcacgcacacc
gtctgcgacgacacggcgacgctgctcttcctcgccgaccaggcctgcgtgacgctgcac
cggtggctctcccgcacgggcgagatcgaccatcccgaccggctggtcttcgacctggac
cccgcgaaggacgacttcgcggccgtacgggacgcggcgcggctgctcggcgggctcctc
gacgacatcggcctgccgtacgccctgatgaccacgggctcacgcggactccacgtcgtg
gtgccgctcaacggccgccatgacttcgacgacgtccgcggcttcgccaaggacgtcgcg
gacacgctcgccgcggcccaccccaaccagttgacgacggctgcccgcaaggaggcgcgg
ggcgaccggctctatctggacgtccagcgcaacgcgtacgcgcagaccgccgtcgcgccg
ttctccgtacgcgccgcaccgggcgccccggtggccatgcccattgcccgggaacagctc
gacgacccggcggtgcacgcccgccactggacgatcgacaacgccttggagcaggcccgc
agcgacccgtgggccgacttcccgcgcaccggacggtccctcggcccggcccgcaggaag
ctgggcgccctgcagggctga

KEGG   Streptomyces alfalfae: A7J05_12165
Entry
A7J05_12165       CDS       T05110                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ssia  Streptomyces alfalfae
Pathway
ssia03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ssia00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    A7J05_12165
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ssia03400]
    A7J05_12165
Enzymes [BR:ssia01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     A7J05_12165
DNA repair and recombination proteins [BR:ssia03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     A7J05_12165
SSDB
Other DBs
NCBI-ProteinID: APY86369
UniProt: A0A1P8TFJ1
Position
3051021..3051920
AA seq 299 aa
MTPITEVEGRRLSLSNLDKVIYPASGFTKGEVLHYYAATAEVLLPHLRDRPVSFLRYPDG
PEGQSFFAKNVPPGAPDWLPTAEVTRSDGATRQVLVQDLASLMWAANTVTEFHTPQWRAE
APARADRLVLDLDPGPPATVVECCRAALWLRDRLRADGFHVYAKTSGSKGLHLLAPLEPT
PSERVTAYAKALAVEAEQEFPELVVHRMTRSLRPGKVFVDFSQNAAAKTTATPYTLRARS
EPTVSAPVTWKEIEACEEPGQLVFTAGDIAPRVAEHGGDLLAPLFDRGLARALPTGSAR
NT seq 900 nt   +upstreamnt  +downstreamnt
atgacgccgatcacagaggtggaggggcgaaggctctcgctcagcaacctggacaaggtc
atctatcccgcgagcggcttcaccaagggcgaggtgctgcactactacgcggccacggcc
gaggtcctcctcccccacctccgcgaccgtcccgtctccttcctgcgctaccccgacggg
cccgaaggccagagcttcttcgccaagaacgtgccgccgggcgcccccgactggctgccg
accgccgaggtgacgcgctccgacggcgccacccgccaggtcctcgtgcaggatctggcc
tcgctgatgtgggcggccaacacggtgacggagttccacaccccgcagtggcgggccgag
gctccggcgcgggcggaccggctggtgctcgacctcgacccgggcccaccggccaccgtc
gtggagtgctgccgggccgcgctctggctgcgggaccggctgcgggccgacgggttccac
gtgtacgcgaagacgtccgggagcaagggcctccatctgctcgccccgctggagccgacg
ccctccgaacgggtcacggcgtacgcgaaggccctcgccgtcgaggccgagcaggagttc
cccgagctggtcgtgcaccgcatgacgcggagcctgcgtccgggcaaggtcttcgtcgac
ttcagccagaacgccgccgccaagacgaccgccaccccctacaccctgcgggcccgcagc
gagccgaccgtctccgcgcccgtgacgtggaaggagatcgaggcgtgcgaggagccgggg
cagctcgtcttcaccgcgggcgacatcgcgccccgcgtcgcggaacacggcggcgacctg
ctggcccccctcttcgaccgcgggctggccagggcgctgccgacggggagcgcgcgatga

DBGET integrated database retrieval system