KEGG   Streptomyces alfalfae: A7J05_12920Help
Entry
A7J05_12920       CDS       T05110                                 

Definition
(GenBank) phosphatase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
ssia  Streptomyces alfalfae
Brite
KEGG Orthology (KO) [BR:ssia00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A7J05_12920
Enzymes [BR:ssia01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     A7J05_12920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP Glyco_hydro_114
Motif
Other DBs
NCBI-ProteinID: APY86495
UniProt: A0A1P8TG02
Position
complement(3223772..3224653)
Genome map
AA seq 293 aa AA seqDB search
MRIDLHTHSTASDGTDTPAELVRNAAAAGLDVVALTDHDTTRGHAEAIAALRGLPEPAGL
SLVTGAELSCRLDGVGLHMLAYLFDPDEPELSRERELVRDDRVPRAKTMIGKLRELGVDV
TWEQVARIAGDGSVGRPHIAEALVELGVVPSVSDAFTPQWLADGGRAYAEKHELDPFDAI
RLVKAAGGVTVFAHPAAAKRGRTVPESVIAELAAAGLDGIEADHMDHAPETRARLRGLAA
DLGLLATGSSDYHGSRKTCVLGEFTTDPEVYGEITRRATGAFPVPGAGGSPAA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcatcgatctgcacactcactccaccgcgtccgacggtacggacacccccgccgag
ctggtgcgcaacgccgccgccgcgggtctcgacgtcgtcgcgctgaccgaccacgacacc
acgcggggccacgcggaggcgatcgccgccctgcgcgggttgccggagccggcggggctg
agcctcgtcaccggcgcggaactctcctgccgcctcgacggcgtgggcctgcacatgctg
gcgtacctcttcgaccccgacgagccggagctgtcccgcgagcgcgagctggtccgcgac
gaccgggtgccgcgcgcgaagacgatgatcggcaagctccgcgagctgggcgtggacgtc
acctgggagcaggtggcccgcatcgcgggggacggctccgtcggccgcccgcacatcgcc
gaggccctcgtcgaactgggcgtcgtgccctccgtctccgacgccttcaccccgcagtgg
ctcgccgacggcggccgcgcctacgccgagaagcacgagctggaccccttcgacgccatc
cgcctggtcaaggcggccggcggcgtcaccgtcttcgcgcaccccgccgccgccaagcgc
ggcagaaccgtgcccgagtccgtcatcgccgagctcgccgcggcgggcctcgacggcatc
gaggccgaccacatggaccacgcccccgagacccgcgccaggctgcgcggcctcgcggcg
gacctcggcctgctggccaccggatccagcgactaccacggcagccgcaagacctgtgtg
ctcggggagttcaccaccgaccccgaggtctacggcgagatcacccgccgggccaccggc
gccttccccgtccccggcgcgggcggaagcccggccgcgtag

DBGET integrated database retrieval system