KEGG   Streptomyces alfalfae: A7J05_15000Help
Entry
A7J05_15000       CDS       T05110                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ssia  Streptomyces alfalfae
Pathway
ssia03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ssia00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    A7J05_15000
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ssia03011]
    A7J05_15000
Ribosome [BR:ssia03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    A7J05_15000
  Bacteria
    A7J05_15000
  Archaea
    A7J05_15000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: APY86867
UniProt: A0A1P8TGX1
Position
complement(3678824..3679171)
Genome map
AA seq 115 aa AA seqDB search
MEARAQARYIRVTPMKARRVVDLIRGMDATEAQAVLRFAPQAASVPVGKVLDSAIANAAH
NYDHSDASSLVISEAYVDEGPTLKRFRPRAQGRAYRIRKRTSHITVVVSSKEGTR
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggaagccagggcccaggcgcggtacatccgcgtcacgcccatgaaggcccgccgcgtg
gtggacctcatccgtggcatggatgccacggaggctcaggcggtcctgcgtttcgccccg
caggccgcgagcgtgccggtcggcaaggtgctggacagcgccattgccaacgccgcgcac
aactacgaccactctgacgcctcttcgctggtcatcagcgaggcgtacgtggatgagggc
ccgaccctgaagcggttccgtccgcgtgcccagggccgtgcctaccggatccgtaagcgg
accagccacatcaccgtggtcgtcagcagcaaggaaggaacccggtaa

DBGET integrated database retrieval system