KEGG   Streptomyces alfalfae: A7J05_17515Help
Entry
A7J05_17515       CDS       T05110                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ssia  Streptomyces alfalfae
Pathway
ssia00450  Selenocompound metabolism
ssia00970  Aminoacyl-tRNA biosynthesis
ssia01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssia00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    A7J05_17515
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A7J05_17515
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ssia01007]
    A7J05_17515
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ssia03016]
    A7J05_17515
Enzymes [BR:ssia01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     A7J05_17515
Amino acid related enzymes [BR:ssia01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   A7J05_17515
Transfer RNA biogenesis [BR:ssia03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    A7J05_17515
 Prokaryotic type
   Other AARSs
    A7J05_17515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-ProteinID: APY87285
UniProt: A0A1P8TI42
Position
4246226..4247854
Genome map
AA seq 542 aa AA seqDB search
MAATGSEKQGKSADSADAKAYYVSTPIYYVNDAPHLGHAYTTVAGDVLTRWHRQRGEKVW
YLTGTDEHGQKIMRTAEANDVTPQEWCDKLVTEAWKPLWEHLDIANDDFIRTTEKRHTDR
VQEFVQDLHDKGEIYKGGYEGPYCVGCEEYKLPGDLIEAEDGTKLCPIHKKPVELLKEEN
YFFKLSEYGDKLLAHYEANPGFIQPESARNEVVNFVKQGLQDLSISRSTFDWGVKVPWDD
KHVIYVWIDALLNYATAVGYGADEEKFASTFPADVHLVGKDILRFHAVIWPAMLLAQGLP
LPGKIAANGWLMVGGEKMSKSNLTGIKPQDLTSHFGVDAYRWYFLRAIAFGSDGSFSWED
FSARYTSELANDYGNLASRVAAMVGKYFGGALPEATAPGDAERAVRDGLTKAVAEADRKI
GEELDFQGGILAIFDFVKQVNGYITEQEPWKVAKDDSPEGKARLATILYTAAESLRAMAV
LLNPLMPETSQKLWDSLGAEPALGPLADQRVQTASTWGRLPAGTTITKGAVLFPRLEEKP
TA
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggcggccactggatccgagaagcaggggaagagcgcggacagcgcggacgcgaaggcg
tactacgtctcgacccccatctactacgtaaacgacgctcctcacctgggccacgcctac
acgaccgttgcaggggacgtgctcacgcgctggcaccgtcagcgcggcgagaaggtgtgg
tacctcaccggcacggacgagcacggtcagaagatcatgcgcacggccgaggcgaacgac
gtcaccccccaggagtggtgcgacaagctcgtcaccgaggcctggaagcccctctgggag
cacctggacatcgcgaacgacgacttcatccgtacgacggagaagcgtcacaccgaccgt
gtgcaggagttcgtccaggatctccacgacaagggcgagatctacaagggcggctatgag
ggcccgtactgcgtgggctgcgaggagtacaagctccccggcgacctcatcgaggccgag
gacggcacgaagctgtgcccgatccacaagaagccggtggagctcctcaaggaggagaac
tacttcttcaagctcagcgagtacggcgacaagctcctcgcccactacgaggcgaacccc
ggcttcatccagccggagtcggcccgcaacgaggtcgtgaacttcgtcaagcagggtctt
caggacctctccatctcccgctcgacgttcgactggggcgtcaaggtcccctgggacgac
aagcacgtcatctacgtgtggatcgacgccctcctgaactacgcgacggccgtgggctac
ggcgcggacgaggagaagttcgcctcgaccttcccggccgacgtccacctggtgggcaag
gacatcctccgcttccacgcggtgatctggcccgcgatgctgctggcccagggcctgccg
ctgcccggcaagatcgcggccaacggctggctgatggtcggcggcgagaagatgtcgaag
tcgaacctgaccggcatcaagccgcaggacctgacctcgcacttcggcgtggacgcgtac
cgctggtacttcctgcgcgcgatcgccttcggcagcgacggctcgttctcgtgggaggac
ttctccgcccgctacacgtccgagctggccaacgactacggcaacctcgcctcgcgcgtg
gccgccatggtcggcaagtacttcggcggcgcgctccccgaggcgacggcccccggcgac
gccgagcgggcggtgcgggacggcctgacgaaggcggtcgccgaggccgaccggaagatc
ggcgaggagctggacttccagggcggcatcctggcgatcttcgacttcgtgaagcaggtc
aacggctacatcacggagcaggagccgtggaaggtggccaaggacgactcgcccgagggc
aaggcccgcctggcgacgatcctgtacacggccgccgagtcgctgcgcgccatggcggtc
ctcctgaacccgctcatgccggagacgtcgcagaagctctgggactccctgggcgcggag
cccgccctcggccccctggccgaccagcgggtccagacggcgtcgacgtggggccggctg
cccgcggggacgacgatcaccaagggcgcggtcctcttcccccgcctggaggagaagccg
accgcgtga

DBGET integrated database retrieval system