KEGG   Streptomyces alfalfae: A7J05_32930
Entry
A7J05_32930       CDS       T05110                                 

Definition
(GenBank) Ku protein
  KO
K10979  DNA end-binding protein Ku
Organism
ssia  Streptomyces alfalfae
Pathway
ssia03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ssia00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    A7J05_32930
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ssia03400]
    A7J05_32930
DNA repair and recombination proteins [BR:ssia03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     A7J05_32930
SSDB
Motif
Pfam: Ku
Other DBs
NCBI-ProteinID: APY89848
UniProt: A0A1P8TQD6
Position
7692858..7693805
AA seq 315 aa
MPRPVWSGAISFGLVTIPIKVLPATEKHSIRFHQYHLADMARVRTKKICELDGQEVTSAE
IGKGFEVDRDTVVEISDEELDDMPLPTAKAIEITAFVPYESIDPVRIGEGYYLQGDGQVA
AKPYTLLRKALERSSKAAVAKFAWHGRERLGLLRVQDEVIVLHAMKWDDEVRSPETLAPK
EVELDEAEIERAVLLVDSMTADGIEGQEWATDRYTAALEEVIAAKAGGKQPPAAAEKEEP
EGKVVDLMAALQQSVQQAQASRGEGGRDDQDATVHEMPTERGAKKPAAKKTAAAKKSTSK
RTTAGKKTTAKKRGA
NT seq 948 nt   +upstreamnt  +downstreamnt
atgccccgccccgtctggtccggcgcgatcagcttcggtctggtgaccatcccgatcaag
gtgctgcccgctaccgagaagcacagcatccgcttccaccagtaccacctggcggacatg
gcgcgggtgcgtacgaagaagatctgcgagctggacggccaagaggtcacgagcgccgag
atcggcaaggggttcgaggtcgacagggacaccgtcgtcgagatcagcgacgaggagctc
gacgacatgccgctgcccaccgccaaggcgatcgagatcaccgcgttcgtgccctacgag
tccatcgacccggtcaggatcggggagggctactacctccagggcgacggccaggtggcc
gccaagccgtacaccctgctgcgcaaggcgctcgaacgcagcagcaaggccgcggtggcg
aagttcgcctggcacggcagggaacggctcgggctgctccgcgtgcaggacgaggtgatc
gtcctgcacgccatgaagtgggacgacgaggtgcgcagcccggagaccctggcgcccaag
gaggtcgaactcgacgaggccgagatcgagcgggccgtgctcctcgtcgactcgatgacc
gccgacggcatcgaagggcaggagtgggccaccgaccgctacaccgccgccctggaggag
gtcatcgcggcgaaggcgggtgggaagcagccgcccgcggctgcggagaaggaggagccc
gaggggaaggtcgtggacctcatggcggcgctccagcagtccgtgcagcaggcgcaggcc
tcccgcggcgagggcggccgagacgaccaggacgcgacggtccacgagatgccgaccgag
cgcggagccaagaagccggccgcgaagaagacggcggcggccaagaagtcgacgtcgaag
cggacgaccgcggggaagaagacgacggccaagaagcgcggggcctag

DBGET integrated database retrieval system