KEGG   Staphylococcus simulans: AL483_01170Help
Entry
AL483_01170       CDS       T04303                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ssif  Staphylococcus simulans
Pathway
ssif03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ssif00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AL483_01170
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ssif03011]
    AL483_01170
Ribosome [BR:ssif03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AL483_01170
  Bacteria
    AL483_01170
  Archaea
    AL483_01170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AMG95500
UniProt: A0A133QWI0
Position
243680..244033
Genome map
AA seq 117 aa AA seqDB search
MEAKAVARTIRIAPRKVRLVLDLIRGKNVGEAVAILKLTNKASSPVVEKLLMSALANAEH
NYDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGKEEAKEA
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaagcggttgctagaactatcagaatcgcacctcgtaaagtcagattagtt
ttagacttaatcagaggcaaaaacgttggtgaagctgttgctattttaaaattaactaac
aaagcatcatcaccagttgttgaaaaattattaatgtccgctttagctaatgcagagcac
aactatgacatgaatacagatgaattagttgttaaagaagcatatgctaacgaaggacca
actttaaaacgtttccgtccacgtgctcaaggacgcgcaagtgcaattaacaaacgtaca
agccacattacaattgtcgtaagtgacggcaaagaagaagctaaagaagcttaa

DBGET integrated database retrieval system