KEGG   Staphylococcus simulans: AL483_04270Help
Entry
AL483_04270       CDS       T04303                                 

Definition
(GenBank) phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating)
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
ssif  Staphylococcus simulans
Pathway
ssif00030  Pentose phosphate pathway
ssif00480  Glutathione metabolism
ssif01100  Metabolic pathways
ssif01110  Biosynthesis of secondary metabolites
ssif01120  Microbial metabolism in diverse environments
ssif01130  Biosynthesis of antibiotics
ssif01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ssif00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AL483_04270
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AL483_04270
Enzymes [BR:ssif01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     AL483_04270
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     AL483_04270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 Shikimate_DH 2-Hacid_dh_C 3HCDH_N ApbA STI1 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AMG96054
UniProt: A0A133QKX1
Position
836281..837690
Genome map
AA seq 469 aa AA seqDB search
MTQQIGVVGLAVMGKNLAWNIESRGYTVSVYNRSKEKTDTMVEESKGKNIHPTYSLEEFV
NSLERPRKILLMVKAGPATDATIEGLLPLLDDGDILIDGGNTNYQDTIRRNKALAESGIN
FIGTGVSGGEVGALTGPSIMPGGQKEAYDKVADILEAISAKADDGAPCVTYIGPDGAGHY
VKMVHNGIEYADMQLIAESYALMKDALHMSHTEIANTFKEWNAGELESYLIEITGEIFNK
LDEDGSPLVEKVMDKAGQKGTGKWTSINALELGVPLTIITESVFARFISSMKDERVAASK
ELTGPSPKFEGNKDEFLEKIRKALYMSKICSYAQGFAQMRKASEENEWNLQLGDLAMIWR
AGCIIRAQFLQKIKEAYDNNPELQNLLLDPYFKDIVTNYQSALRDVVAESVANGVPTPGF
AASINYFDSYRSENLPANLIQAQRDYFGAHTYQRKDQEGTFHTHWAEEK
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaacaaattggtgtagtcggtttagccgtaatgggtaaaaacctagcttggaat
attgaatctcgtggctatacagtctcagtttataaccgctcaaaagaaaaaactgacaca
atggtcgaagaatcaaaaggcaaaaatattcacccaacttattctttagaagaatttgtg
aattcacttgaacgtccacgtaaaattcttttaatggttaaagcaggtccggcaacggat
gcgacaatcgaaggtttattaccattattagatgatggtgatattttaatcgatggtggt
aatacaaactatcaagatacgattcgtcgtaacaaagcattagcagaaagcggcattaac
tttattggtacaggtgtatcaggaggagaagtaggcgcattgactggtccttcaatcatg
cctggtggtcaaaaagaagcatatgacaaagttgctgatatcttagaagcaatttctgct
aaagctgacgatggtgcgccttgtgtaacatacattggtccagacggtgcaggacattac
gttaaaatggtacacaatggtatcgaatatgctgacatgcaattaatcgctgaaagttat
gcattaatgaaagatgcattgcatatgtcacatactgaaatcgcaaatacattcaaagaa
tggaatgcaggcgaacttgaaagttacttaattgaaattactggtgaaatcttcaacaaa
cttgatgaagacggttccccattagttgaaaaagtaatggataaagcaggtcaaaaaggt
actggtaaatggacttctattaatgcattagaactaggtgtaccattaacaattattact
gaatctgtattcgcacgctttatctcatcaatgaaagatgagcgcgtcgctgcttctaaa
gaattaactggcccatcaccaaaatttgaaggtaataaagatgagttcttagaaaaaatc
cgtaaggcgctttatatgagtaaaatctgttcatatgcacaaggttttgcgcaaatgcgt
aaagcaagtgaagaaaacgaatggaacttacaacttggcgatttagctatgatttggaga
gcaggttgtattattcgtgcacaattcttacaaaaaattaaagaggcatatgataataat
ccagaattacaaaacttattattagatccttatttcaaagatatcgtaacaaattatcaa
tcagcattacgtgatgttgttgctgaaagtgttgcaaatggtgttcctacacctggattt
gctgcgagcattaattactttgacagttatcgttcagaaaacttaccagcaaacttaatt
caagcacaacgtgactacttcggtgcgcacacttatcaacgtaaagaccaagaaggtaca
ttccatacacattgggctgaagaaaaataa

DBGET integrated database retrieval system