KEGG   Staphylococcus simulans: AL483_05170Help
Entry
AL483_05170       CDS       T04303                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ssif  Staphylococcus simulans
Pathway
ssif00480  Glutathione metabolism
ssif00590  Arachidonic acid metabolism
ssif01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssif00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AL483_05170
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AL483_05170
Enzymes [BR:ssif01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AL483_05170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AMG96231
UniProt: A0A2X3QJH4
Position
1030860..1031333
Genome map
AA seq 157 aa AA seqDB search
MSIYDIEVTKTDGTTYQLDQYKGKVMLIVNTASQCGFTPQFEGLQELYEQYQDQGFVVLG
FPCNQFGKQEPGNGQEAMQNCKINYGVTFPMHEKIKVNGPEQHPLYQYLTEQQDGFFNSK
IKWNFTKFLIDRDGNVVNRFSPQKNPSQIKSDIEELL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgagcatatatgatattgaagttacaaaaaccgatggcacaacctatcaactagatcaa
tacaaaggaaaggtcatgttaatcgtcaacacagcgagtcaatgtggctttacgccacag
tttgaaggcttgcaagagctttacgaacaataccaagatcaaggctttgtcgtattagga
ttcccttgtaaccaatttggcaagcaagaacctggtaacggtcaagaagccatgcaaaat
tgtaaaattaattatggggtaactttcccaatgcacgaaaaaattaaagtgaacggacct
gaacaacatccactttatcaatacttaacagaacaacaagatggatttttcaatagtaaa
atcaaatggaatttcactaagttcttaatagatagagatggcaatgtagtcaatcgtttc
tcaccacaaaaaaatccaagtcaaatcaaatcagatatcgaagaactattataa

DBGET integrated database retrieval system