KEGG   Staphylococcus simulans: AL483_07365Help
Entry
AL483_07365       CDS       T04303                                 

Definition
(GenBank) cysteine desulfurase
  KO
K11717  cysteine desulfurase / selenocysteine lyase [EC:2.8.1.7 4.4.1.16]
Organism
ssif  Staphylococcus simulans
Pathway
ssif00450  Selenocompound metabolism
ssif01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssif00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AL483_07365
Enzymes [BR:ssif01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     AL483_07365
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.16  selenocysteine lyase
     AL483_07365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP Aminotran_1_2 DegT_DnrJ_EryC1 Beta_elim_lyase SelA Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AMG97619
Position
complement(1515955..1517196)
Genome map
AA seq 413 aa AA seqDB search
MAETTLNVNEVIEDFPILKQQVNGKRLAYLDTTATSQTPLQVIEAIDDYYKRYNSNVHRG
VHTLGSLATDGYEGARETVRRFINARYFEEIIFTRGTTASINLVARSYGDANVSEGDEIV
VTEMEHHANIVPWQELARRKGATLKFIPMTETGELNIEDVKATINDNTKIVAIAHVSNVL
GTINDVKEITKVAHEHGAIISVDGAQAAPHMKIDVQDLDVDFYSFSGHKLLGPTGIGVLY
GKRSLLKDMEPIEYGGDMIDFVGKYEATWTDLPTKFEAGTPLIAQAIGLAEAIKYLENIG
FDAIHQHEKELTEYAYEQMDAIEDLEIYGPPKDRRAGVITFNLKDIHPHDVATALDTEGV
AVRAGHHCAQPLMKWLNQSSTARASFYIYNTKEDIDQLIYALNQTKEFFSYEF
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtggccgaaacaacactaaatgttaatgaagttattgaagattttccaatcttgaaacaa
caagtcaatggcaaacgcttagcttatttagatacaacagcgacaagtcaaacaccactt
caagtaatcgaagcgattgacgattattataaacgttacaattctaatgtgcatcgtggt
gtacacacactcggctcattagcaacagatggttatgaaggtgcacgcgaaacagtaaga
cgtttcattaatgcacgttactttgaagaaattattttcacaagaggtacaacagcttct
attaacttagtcgcacgtagttatggtgatgcgaatgtttcagaaggcgatgaaattgtc
gtaactgaaatggaacatcatgctaacatcgtaccttggcaagaattagcacgccgtaaa
ggtgcaactttaaaattcatcccgatgacagaaacaggtgaattaaacatcgaagatgtg
aaagctacaattaatgacaacactaaaattgtagcgattgcacatgtatctaacgtttta
ggtacaatcaacgatgtgaaagaaattacgaaagttgcgcatgaacatggtgcaattatc
agtgtggacggtgcacaagcagcaccacacatgaaaattgatgtgcaagatttagatgta
gacttttacagtttcagcggacacaaattgcttggtcctacaggtattggtgtcttatat
ggtaaacgcagtctgcttaaagatatggaacctatcgaatacggcggtgacatgattgac
ttcgtaggtaaatatgaagcaacttggacagacttgccaacaaaattcgaagcaggtaca
cctttaattgcacaagctattggcttagctgaagcaattaaataccttgaaaacattggt
tttgatgcgattcatcaacatgaaaaagagttgactgaatatgcatacgaacaaatggat
gcgattgaagacttagaaatctatggtccgccaaaagacagacgtgctggtgtaattact
ttcaatttgaaagacattcatccacatgacgttgcgacggctttagacacagaaggtgtt
gctgtacgtgcaggacatcactgtgcacaaccattaatgaaatggttgaatcaatcttca
acagcaagagcaagtttctatatctataatacaaaagaagacattgatcaattaatttac
gctttaaaccaaacgaaggagtttttctcatatgaattttaa

DBGET integrated database retrieval system