KEGG   Staphylococcus simulans: AL483_09220Help
Entry
AL483_09220       CDS       T04303                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ssif  Staphylococcus simulans
Pathway
ssif00450  Selenocompound metabolism
ssif00970  Aminoacyl-tRNA biosynthesis
ssif01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssif00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AL483_09220
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AL483_09220
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ssif01007]
    AL483_09220
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ssif03016]
    AL483_09220
Enzymes [BR:ssif01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AL483_09220
Amino acid related enzymes [BR:ssif01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AL483_09220
Transfer RNA biogenesis [BR:ssif03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AL483_09220
 Prokaryotic type
   Other AARSs
    AL483_09220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f ARL2_Bind_BART T4_neck-protein PilM
Motif
Other DBs
NCBI-ProteinID: AMG96988
UniProt: A0A133QGK5
Position
complement(1873907..1875907)
Genome map
AA seq 666 aa AA seqDB search
MAKDTFYITTPIYYPSGKLHIGHAYSTVAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEK
AHKAGLTELEYLDDMIKGIKALWEKLEISNDDFIRTTEKRHKEVVEKVFERLLAQGDIYL
GEYEGWYSVPDETYYTESQLDDPEYDNDGNIIGGKSPDSGHEVELVKEESYFFNISKYAD
RLLEFYDANPEFIQPPSRKNEMINNFIKPGLTDLAVSRTTFDWGVQVPSNPKHVVYVWID
ALVNYISALGYLSDDDSLFQKYWPADLHLMAKEIVRFHSIVWPILLMALDLPLPKRVFAH
GWILMRDGKMSKSKGNVVDPNVLIDRYGLDATRYYLMRELPFGSDGVFTPEAFVDRTNFD
LANDLGNLVNRTIAMINKYFGGELPAYEGPKHDLDAEMEQFALDTVKEYHQNMENLQFSV
ALSTVWKFISRTNKYIDETTPWILAKDDSQREMLGNVMAHLVENIRFAAVLLRPFLTHAP
REIFAQLHINSPELYELDSLNSYGALTEPITVTEKPKPIFPRLDTEAEVAFIKDSMQGSA
PQAEEAKEETKEEAQEDAKPQITIKDFDKVEIKAATVMDAENVKKSDKLLKIQVDLGEEQ
RQIVSGIAKFYEPDDIIGKKVAVVTNLKPAKLMGRKSEGMILSAEKDGVLTLVSLPNAIP
NGAVIK
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagatacattttatataacaacacctatttattacccgagtggtaaattacac
attgggcatgcctattcaactgtagcaggcgacgtcattgcgcgctacaaacgcatgcaa
ggctatgatgtacgttatttgacaggtacagacgaacatggccaaaaaattcaagaaaag
gcacataaagctggccttacagaattagaatacctagatgacatgattaaaggtattaaa
gcgttatgggaaaaattagagatttcaaatgatgactttatcagaacaactgaaaaacgt
cacaaagaagttgtagagaaagtctttgaacgtctattagcacaaggtgatatttacctt
ggtgaatatgaaggctggtattctgtaccggatgaaacttactatacagaatctcaactt
gatgatccagaatacgataatgatggcaatattattggtggtaaaagcccagattctgga
catgaagtagaattagttaaagaagaaagttacttcttcaatatttctaaatatgcggat
cgcttattagaattctatgatgcgaaccctgaattcattcaacctccttctcgtaagaac
gaaatgattaacaactttattaaaccaggattaacagacttggctgtctcacgtacgaca
tttgattggggcgtacaagtaccgtctaatcctaaacacgttgtttacgtatggattgat
gcgttggtgaactatatttcagctcttggttatttatcagatgatgatagcctattccaa
aaatattggccggctgatttacacttaatggcgaaagaaattgtgcgtttccactctatc
gtgtggccgatcttattaatggcgctagacttaccgcttccaaaacgcgtcttcgcacac
ggttggattttaatgagagacggtaaaatgagtaaatctaaaggtaacgtcgtagatccg
aacgtattaatcgatcgttatggcttagatgcgacacgttactacttaatgcgagaatta
ccatttggttctgacggtgtcttcacaccagaagcgttcgttgaccgtacaaactttgat
ttagccaatgacttaggtaacttagtcaaccgtacgattgcgatgatcaacaaatacttc
ggcggcgagttgcctgcgtatgaaggaccaaaacatgacttagatgctgagatggaacaa
ttcgcattagatacagtcaaagaataccatcaaaatatggaaaacttacagttctctgtt
gcactttcaacagtatggaagttcatcagccgtacgaataaatatattgatgaaacaaca
ccatggattttagctaaagatgacagccaaagagaaatgcttggcaacgtgatggcacac
ttagtggaaaatatccgcttcgcagctgtcttattacgcccattcttaacacacgcacca
cgtgaaatctttgcgcaattacacatcaatagtcctgaactatatgaactagacagctta
aattcatatggtgcattaactgaaccgattacagtaactgaaaaacctaaaccgattttc
cctcgtttagatacagaagcagaagtggcatttattaaagactcaatgcaaggttcagca
ccacaagctgaagaagcaaaagaagaaacaaaagaggaagcacaagaagacgcgaaacct
caaatcacaattaaagatttcgataaagttgaaatcaaagctgcaacagtaatggatgca
gaaaatgtgaagaaatcagataaactcttaaaaattcaagtagatttaggcgaagaacaa
cgccaaatcgtttcaggtatcgcaaaattctatgaacctgatgatattatcggtaaaaaa
gtcgcagttgtgacgaacttgaaaccagcaaaattaatgggccgtaaatcagaaggtatg
attctatcagcagaaaaagacggtgtcttaacactggtcagcttgccgaatgcgattcct
aacggtgcagtgattaaataa

DBGET integrated database retrieval system