KEGG   Staphylococcus simulans: AL483_09795Help
Entry
AL483_09795       CDS       T04303                                 

Definition
(GenBank) cystathionine gamma-synthase
  KO
K01760  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Organism
ssif  Staphylococcus simulans
Pathway
ssif00270  Cysteine and methionine metabolism
ssif00450  Selenocompound metabolism
ssif01100  Metabolic pathways
ssif01110  Biosynthesis of secondary metabolites
ssif01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssif00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AL483_09795
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AL483_09795
Enzymes [BR:ssif01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.13  cysteine-S-conjugate beta-lyase
     AL483_09795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_1_2 Aminotran_5 Met_gamma_lyase GDC-P
Motif
Other DBs
NCBI-ProteinID: AMG97088
UniProt: A0A2X3QVN2
Position
1995618..1996790
Genome map
AA seq 390 aa AA seqDB search
MSLSSETNLIKYHQFPHILAANPPLYDSSTFPTALIGSEVPYDYARSGHPNRALLEEKLA
ALEDAEYGIAYNSGIGAISAVFFLLKSGDHLIIPNDVYGGTYRLCEHVLPGFNIEVTAVD
TTNPLAVEQAIQENTKLIHLETPSNPLFKVTDIQAIADVAKKHNILVSVDNTFLTPLSQK
PLHLGADIVIHSATKFLSGHSDLIAGAVVTNNAEVAESLQFLQNTLGSGLSAQDSWTLTK
HLKTLYVRWNQSVKNTEKIVEFLKSRPEITDVYYPGNDEINQRQAENGGAVLGFRLSEAE
KVPTFAKALKIPQIAVSLGGIQTIVSHPATMSHASVPEDVRNERGITFDLLRLSVGLEDP
DELIADFEAALEEAYYEPVSTNFEQERISS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtcactatcatcagaaacaaatttaattaagtatcatcaattcccgcacattttagca
gccaacccgccactttatgactcatcgactttcccgacagcattgattggttcagaggtc
ccttacgattacgcaagatcaggccacccgaaccgagcattgttagaagaaaagcttgca
gcacttgaagatgccgagtacggtatcgcttataactcaggaatcggagcaatttcagca
gttttcttcttactgaaatcaggagatcacttaattattccgaatgatgtttacggtggg
acataccgcttatgcgaacatgttttaccaggatttaatatcgaagtcacagcagtagat
acgacaaacccattagcagttgaacaagcgattcaggaaaatacgaaactaattcatctg
gaaacaccgtcaaatccattatttaaagtgacagatattcaagccattgcggatgtcgca
aagaaacataatatccttgtttcagtcgacaatacattcttaacacccctatcacaaaag
ccattgcatttaggtgctgacattgtgattcatagtgccactaaattcttaagcggccac
agtgacttaattgcaggggcagttgtaacaaacaacgcggaagttgcagaatcattacaa
ttcttacaaaacactttaggaagcggattatcagctcaagacagctggacactgacaaag
catcttaaaacgctttatgtacgatggaatcaatcagtgaaaaacactgaaaagattgtt
gaattcttaaaatcacgtcctgaaattactgatgtatattacccaggaaatgatgaaatc
aatcaacgccaagctgaaaatggcggtgcagtacttggcttcagattaagcgaagcagaa
aaggtaccgacatttgcgaaagcattaaaaataccgcaaatcgcagtcagcctaggcggt
attcaaactatcgtctctcatccagccacaatgtcacatgcttctgttccagaagatgtg
cgtaacgaacgcggaattacgttcgatctcttgagactgagtgtgggcttagaagaccca
gacgagttgattgcagattttgaagcagcattggaggaagcatactatgagccggtttct
acaaactttgagcaagaacgtattagtagctga

DBGET integrated database retrieval system