KEGG   Staphylococcus simulans: AL483_10535Help
Entry
AL483_10535       CDS       T04303                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ssif  Staphylococcus simulans
Pathway
ssif00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ssif00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AL483_10535
Enzymes [BR:ssif01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AL483_10535
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AL483_10535
    1.1.1.-  
     AL483_10535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 ADH_N_assoc Met_10 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AMG97220
Position
2154551..2155573
Genome map
AA seq 340 aa AA seqDB search
MKAAVWYGEKDIRVQERQLKELSSDDVKVKVAWAGICGSDLHAYLHPDSVPMERGTVLGH
EFSGVVEEVGSDVTELKKGDRVCIYPMMFEDQENALYERFVTLDAVGAQIDGGFAEYTII
PQNSVFKVPEELSLERAALVEPASVAYQAVKDAGIKEGDIVTVYGAGPIGLFSIAAAKAQ
GAKQVIAIDIAEERLKIAEAMGADTTIDSTKTNPVEAIRKMYPEGADVSIEAAGVADTFT
QSIQSTRVRGTVMIVSFHTQSLEFNVPQNLLFTGVNIMGSVGYGNDTYNQVMNELASGAL
ASEPIITSKITLDHIKEDGFEKLIQDKSQEKILIQLNTID
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagccgtttggtatggcgaaaaagatattagagttcaagagagacaattaaaa
gaactgagcagtgatgatgtcaaagtgaaagtggcttgggcaggtatttgcggttcagac
ttgcacgcatatttgcatccagactcagtaccgatggagagaggaactgtgcttggacat
gaattttcaggtgtagtagaagaagtaggttcagatgttacagagcttaaaaaaggcgat
cgtgtttgtatttatccgatgatgttcgaagatcaagagaatgcattatatgaacgcttt
gttactttagatgcggttggtgcacagattgatggaggatttgctgaatatacaatcatt
ccgcagaattctgtattcaaagtaccagaagagctatcattagaacgagcagcattggta
gagccggcatctgttgcgtatcaagctgttaaagatgctggaattaaagaaggggatatt
gtgactgtctatggtgctgggccaatcggtctgttctctattgcggccgcaaaagcacaa
ggcgcaaagcaagtaatcgcaattgatattgctgaagaacgtttgaaaatagctgaagca
atgggtgcagatacaacgattgactctacaaaaacaaatccagtagaggccattagaaaa
atgtatccagaaggtgcagatgtgagtatagaagcagccggtgtggcagatacatttaca
caatccattcaatctacacgtgtaagaggcacagtcatgattgtaagtttccacacgcaa
agtttagaattcaatgtaccgcaaaacttattgtttacgggtgtaaatattatgggttct
gttggatatggtaatgacacatacaatcaagttatgaatgaattagcttccggtgcatta
gcgtcagaacctattattactagtaaaatcactttagaccatattaaagaagatggtttt
gaaaaattgattcaagataagtcgcaagaaaaaatcttaatccaactcaatacgatagac
taa

DBGET integrated database retrieval system