KEGG   Staphylococcus simulans: AL483_11940Help
Entry
AL483_11940       CDS       T04303                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ssif  Staphylococcus simulans
Pathway
ssif00071  Fatty acid degradation
ssif00072  Synthesis and degradation of ketone bodies
ssif00280  Valine, leucine and isoleucine degradation
ssif00310  Lysine degradation
ssif00362  Benzoate degradation
ssif00380  Tryptophan metabolism
ssif00620  Pyruvate metabolism
ssif00630  Glyoxylate and dicarboxylate metabolism
ssif00640  Propanoate metabolism
ssif00650  Butanoate metabolism
ssif00900  Terpenoid backbone biosynthesis
ssif01100  Metabolic pathways
ssif01110  Biosynthesis of secondary metabolites
ssif01120  Microbial metabolism in diverse environments
ssif01130  Biosynthesis of antibiotics
ssif01200  Carbon metabolism
ssif01212  Fatty acid metabolism
ssif02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ssif00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AL483_11940
   00630 Glyoxylate and dicarboxylate metabolism
    AL483_11940
   00640 Propanoate metabolism
    AL483_11940
   00650 Butanoate metabolism
    AL483_11940
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AL483_11940
   00072 Synthesis and degradation of ketone bodies
    AL483_11940
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AL483_11940
   00310 Lysine degradation
    AL483_11940
   00380 Tryptophan metabolism
    AL483_11940
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AL483_11940
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AL483_11940
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AL483_11940
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssif04147]
    AL483_11940
Enzymes [BR:ssif01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AL483_11940
Exosome [BR:ssif04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AL483_11940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMG97483
Position
2512593..2513744
Genome map
AA seq 383 aa AA seqDB search
MREAVIIEAKRTPIGKYGGIFKHLEPEALLKPLIDELIQLHPSIASNIQDVIIGNTVGNG
GNLARKSLLHAGLSSDIPGMTIDRQCGSGLEAINLACRMIQAGAGDIYLAGGVESTSRAP
WKIQKPQSLYEKHPPEIYERAPFTPESMGDPSMLEAAENVAQVYQVARERQDAFAARSHK
KYFEHLSQIQREIVPLTIRGEQVTQDEAPKQKMSAQRLARLKPLFDAGSVTVGNACPKSD
GAALALVMSREKAEALGLKGQLKFIDAQVSGVNPKLLGIGPVPATEQLLMRHRLSISDMD
WVAFNEAFSSQVLASMDLLGIEEKQVNPFGGALAEGHPYGASGANLVARLISILTYFPGN
HALATMGIGGGLGISTLFEKVEH
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagcagtcattattgaagcgaaacgaacaccaataggcaagtatggcggtatc
tttaaacatttagaacctgaagctttactcaagccgcttatcgatgaattgatacagctg
catccgtctatcgcttcaaatatacaagatgtcatcattggtaatacagtaggtaacggc
ggtaatctcgcgcgtaaatcattacttcatgccggactctcttctgatattccaggtatg
acgatagatcgccaatgcgggtcaggtttagaagcaatcaacctggcatgtcgtatgatt
caagccggtgcaggagatatttatcttgcaggaggagtggaatcaacaagtcgagcacca
tggaaaattcaaaaaccgcaatcgctgtatgagaaacacccgccggaaatatatgaacgt
gcgccttttaccccagaatctatgggagatccaagcatgttagaagcagctgaaaatgta
gcgcaagtttatcaagttgctcgtgaacgtcaagatgcttttgcggcacgtagtcataaa
aaatactttgaacatttatcacaaatccaacgtgaaatcgtacctttaacgattcgtggt
gaacaagtaacacaagatgaagcacccaaacaaaagatgtctgcacaacgtttagcacga
ttgaaaccgctgttcgatgcaggctcagtcactgtcggcaatgcttgtcctaaaagtgac
ggtgctgcgttagcgttagttatgtcacgtgaaaaagcagaagcactcgggttaaaaggt
caattgaaatttatagatgcacaggtctcaggagtcaatcccaaattattaggtattgga
cctgtccctgcgactgaacaactattaatgagacatcgattatctatttcagatatggat
tgggtcgcatttaatgaagctttcagctctcaagtactcgcttctatggacttgcttggt
atagaagaaaaacaagtgaatccatttggtggtgcactcgctgaaggacatccatatggc
gcaagcggcgcaaatttagtcgcacgactgatttctattcttacgtatttccctggaaat
catgcattagctacaatgggcattggtggcggattaggtatttcgactttatttgagaag
gtagagcactaa

DBGET integrated database retrieval system