KEGG   Solibacillus silvestris DSM 12223: SOLI23_06395Help
Entry
SOLI23_06395      CDS       T04506                                 

Definition
(GenBank) succinyl-CoA--3-ketoacid-CoA transferase
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
ssil  Solibacillus silvestris DSM 12223
Pathway
ssil00072  Synthesis and degradation of ketone bodies
ssil00280  Valine, leucine and isoleucine degradation
ssil00650  Butanoate metabolism
ssil01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssil00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SOLI23_06395
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SOLI23_06395
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SOLI23_06395
Enzymes [BR:ssil01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     SOLI23_06395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: AMO85224
Position
complement(1339477..1340136)
Genome map
AA seq 219 aa AA seqDB search
MTLSNRERIAIRAEKEIEHGNYVNLGIGMPTLVANYISPEKTVILQSENGLLGIGPYPTK
EEVDPDLINAGKETITTIPGSSFFTSAESFAMIRGGHIDVAILGGMEVSEKGDLANWMIP
GKMIKGMGGAMDLVQGAKKIIVIMDHVSKDGSPKIKKECSLPLTGKGVVNKIITERALIE
VTSRGLELKEVFEGYSVEDVIQSTEANLIVENVKESVSI
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgactttatctaatagggaacgaattgccattcgggctgaaaaagaaattgaacacggt
aactatgtcaatttaggaatcgggatgcctacattagtcgcaaattatatatctccagaa
aaaaccgtcatcttgcaatccgaaaatggtttgcttggaatcggaccgtatccgacaaaa
gaagaagttgatccagatttaatcaatgccggaaaagagacaatcacaacaatacctggc
tcctcttttttcacaagtgcagaatcatttgcaatgatccgcggcggacatattgatgtt
gccattttgggtggaatggaagtctccgaaaaaggcgatttagccaactggatgattccg
ggaaaaatgattaaaggtatgggtggtgcgatggatttagtacagggtgcaaaaaaaatt
attgtcataatggatcatgtctcgaaagacggttcaccaaaaataaaaaaagaatgttct
ttacctttaacaggcaaaggcgtagtcaataaaattattacggaaagagccctgattgaa
gtaacatcacgtggtttagaactgaaagaagtatttgaaggatattcagttgaggatgta
attcaatcaacggaagcaaatttaattgttgagaatgtaaaagagagcgtttctatttaa

DBGET integrated database retrieval system