KEGG   Solibacillus silvestris DSM 12223: SOLI23_13785Help
Entry
SOLI23_13785      CDS       T04506                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ssil  Solibacillus silvestris DSM 12223
Pathway
ssil00071  Fatty acid degradation
ssil00072  Synthesis and degradation of ketone bodies
ssil00280  Valine, leucine and isoleucine degradation
ssil00310  Lysine degradation
ssil00362  Benzoate degradation
ssil00380  Tryptophan metabolism
ssil00620  Pyruvate metabolism
ssil00630  Glyoxylate and dicarboxylate metabolism
ssil00640  Propanoate metabolism
ssil00650  Butanoate metabolism
ssil00900  Terpenoid backbone biosynthesis
ssil01100  Metabolic pathways
ssil01110  Biosynthesis of secondary metabolites
ssil01120  Microbial metabolism in diverse environments
ssil01130  Biosynthesis of antibiotics
ssil01200  Carbon metabolism
ssil01212  Fatty acid metabolism
ssil02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ssil00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SOLI23_13785
   00630 Glyoxylate and dicarboxylate metabolism
    SOLI23_13785
   00640 Propanoate metabolism
    SOLI23_13785
   00650 Butanoate metabolism
    SOLI23_13785
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SOLI23_13785
   00072 Synthesis and degradation of ketone bodies
    SOLI23_13785
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SOLI23_13785
   00310 Lysine degradation
    SOLI23_13785
   00380 Tryptophan metabolism
    SOLI23_13785
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SOLI23_13785
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SOLI23_13785
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SOLI23_13785
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssil04147]
    SOLI23_13785
Enzymes [BR:ssil01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SOLI23_13785
Exosome [BR:ssil04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SOLI23_13785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMO86593
Position
complement(2794642..2795889)
Genome map
AA seq 415 aa AA seqDB search
MDVNLAKVFINTIKGELAMSNIVIIDSVRTAIGKLGGSLKDVEADYLGGTVLNEITRRTN
IDAQLIDEIILGQGKQSTDTPNLARVASLRAQLPIEISGYTVHRQCGSGLQAINNAALQI
GGGLADFIIAGGVESMSTAPYYIRNGRYGYGAGNGQILDPNTESQPRSQPIDQYGSFTMG
ETAENLAVKYSISREEQDEFAYRSQQLAHDAINKGIFKSEIVPYEIKQRKSTITFDTDEH
PRLSSVEDLAKLKAVFKKDGTVTAGNSSGRNDGASALLIASEEAAQKHGFKPKARIIAQA
AAGVSPEIMGIGPVPATQKALKQAGLTLQDVGIIELNEAFAAQSLAVIKEWGIPVDRINV
NGGAIAFGHPIGATGAILMTKLLHEMERRGERYGLVTLCIAGGLGISTIVENLQV
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
ttggacgtaaatctggcgaaggtttttataaatacgattaaaggggaacttgctatgtca
aacattgtcattatcgattcggtccgaacagcgatcggaaagctgggcgggagcctgaaa
gatgtagaggccgattatttgggcggaactgtactcaatgaaattacgcgccgcacaaat
attgatgcacagctaatcgatgaaatcattttaggacagggaaaacaaagtaccgataca
ccaaatttagcacgtgtagcatcactaagagcacaactgccaatagaaatttcaggatac
acggtgcatcgccaatgcggatctggtttacaggcaatcaataatgcggcactgcaaatc
ggaggaggtttggcggactttattatcgcgggtggtgtagaaagcatgagcacggcacca
tattatattcgcaacggtcgctacggttatggagcaggcaacggacagattttggatccg
aacacagaaagtcagccccgttcacagccgatagatcaatacggttcttttacaatggga
gaaactgctgaaaatttagccgttaagtacagtatttcacgtgaggagcaagatgaattc
gcgtaccgcagccaacaactggcacatgatgcaattaataaaggcattttcaaatctgaa
atcgtgccatatgaaattaaacaaagaaaatcgaccatcacctttgatacggacgagcac
ccacgtttatcgagtgtagaagatttggcaaaacttaaagcggtatttaaaaaagacggg
actgtaactgccggcaatagtagcggaagaaatgacggtgcttctgcattattaatcgca
tcagaagaagcagcccaaaaacacggttttaaaccgaaagctcgtattattgcccaggct
gcagccggtgtatcaccggaaatcatgggtattggcccggtgccggcgacacaaaaagca
ttgaaacaagccggacttactttacaggacgtcggaataatcgagttaaatgaagctttc
gctgcacagtcgctcgcggttattaaagagtggggcattccggttgaccggattaacgta
aatggtggggccattgcatttggtcacccgattggagcaacaggggcaattttaatgaca
aaattgcttcatgagatggagcgccgaggagaacggtacggtcttgttacattatgtatt
gcaggcggtttaggaatctctacaattgttgagaatttacaagtatag

DBGET integrated database retrieval system