KEGG   Solibacillus silvestris DSM 12223: SOLI23_16260Help
Entry
SOLI23_16260      CDS       T04506                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
ssil  Solibacillus silvestris DSM 12223
Pathway
ssil00520  Amino sugar and nucleotide sugar metabolism
ssil01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssil00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SOLI23_16260
Enzymes [BR:ssil01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     SOLI23_16260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AMO87052
Position
complement(3299571..3300755)
Genome map
AA seq 394 aa AA seqDB search
MEKTWCIGPLQIIREQRIEDDCYAVIEGGKIVQFCKRDELPEKVDLVETKTAYKMMPGMI
DQHIHGISGADVMDGTESSLNTISTALAKHGVTTFLATTMTAEENQIERVVQAIANMKNN
VKGAKIAGIHLEGPFISPIQKGAQSDQFIIKPSVEIFDHLNRSAQYEIKLVTLAAELDKG
HKLATYLKHNGIVASIGHSDATYDETKVLLRQQLIQNATHFCNGMRPIHHREPGLQVALL
QSECMLEIIADGFHIHPDMIRFIYDKIGEDRMILISDSMRATGLTDGIYDLGGQQVRVED
GLCKLVGSDALAGSTLNLNKARKNMKDWLGLSNVTLAKLTATNSAKLLGLFENKGSIEIG
KDADFYIVNENEEVVLTVSEGKIIYENFKKEGLQ
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaacatggtgtattggaccactccaaattatccgggaacagcggatagaggat
gattgttacgctgtaattgaaggtggaaaaatagttcagttttgcaaaagggatgaatta
cctgaaaaggtcgatctggtagaaacaaagacagcttataaaatgatgccggggatgatt
gatcagcatattcacggaatatcaggtgctgatgtaatggacggaacggaaagcagtcta
aatacgataagtacggcacttgcaaaacacggggtgacaacctttttagcgacaacgatg
actgcggaagaaaatcaaatcgagcgtgttgtacaagcgattgcgaatatgaaaaacaat
gtaaaaggtgcaaaaattgcaggcatacatttagaaggtcctttcattagcccgattcaa
aaaggggcacagtccgatcagtttattataaaaccttctgtagaaatatttgaccatcta
aacaggtctgcccaatacgaaattaagcttgttacactagcggcagagctagataaaggc
cataagcttgcaacgtacttaaaacataacggcattgtagcatccattggtcactcagat
gccacctatgatgagacaaaggtattattgagacaacagcttattcagaatgccactcat
ttttgtaatgggatgaggccgatccatcatagggagcccggcttgcaggtcgcattactg
caaagtgagtgtatgctggaaattattgctgacggatttcatattcatccggacatgatt
cgctttatttacgacaagattggtgaagaccgaatgatattaatatcagacagtatgcgc
gcaaccggattaacagacggtatttatgatttaggtggacaacaagtccgggtagaagat
ggcttatgtaaattagtcgggagtgacgcgcttgctggaagtacgctgaatttaaacaag
gcccgaaaaaatatgaaagactggctcggattatcaaatgtgacactagctaagctgact
gcaactaacagtgcaaagctgttagggttgtttgaaaataaagggtcaattgaaattggt
aaagatgctgacttttatatagttaacgaaaacgaagaagttgtattaactgtttcagaa
ggaaaaataatttacgaaaattttaaaaaggagggattgcagtga

DBGET integrated database retrieval system