KEGG   Streptococcus suis D12 (serotype 9): SSUD12_0256Help
Entry
SSUD12_0256       CDS       T02021                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ssk  Streptococcus suis D12 (serotype 9)
Pathway
ssk00010  Glycolysis / Gluconeogenesis
ssk00071  Fatty acid degradation
ssk00350  Tyrosine metabolism
ssk00625  Chloroalkane and chloroalkene degradation
ssk00626  Naphthalene degradation
ssk01100  Metabolic pathways
ssk01110  Biosynthesis of secondary metabolites
ssk01120  Microbial metabolism in diverse environments
ssk01130  Biosynthesis of antibiotics
ssk01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUD12_0256 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    SSUD12_0256 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SSUD12_0256 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SSUD12_0256 (adhA)
   00626 Naphthalene degradation
    SSUD12_0256 (adhA)
Enzymes [BR:ssk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SSUD12_0256 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 MCR_alpha Methyltransf_25 Methyltransf_31 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: AER18595
UniProt: G7SDA5
Position
complement(267193..268218)
Genome map
AA seq 341 aa AA seqDB search
MKAVVVNPESTGVVVVEKELRPLEAGEALVQIEYCGVCHTDLHVANGDFGKVPGRVLGHE
GIGIVTEIAPGVTSLKVGDRVSVAWFFQGCGMCEYCTTGRETLCRTVKNAGYSVDGGMAE
QCIVTADYAVKVPEGLDPAQASSITCAGVTCYKAIKEAHLEPGQWIAIYGAGGLGNLAVQ
YAKKVFNAHVIAVDINNDKLELAKEVGADVTINGLEVEDVPGYIKEITGGGVHSTVVTAV
SKVAFNQAIDSVRAGGYVVAVGLPSEYMDLSIVKTVLDGIKVVGSLVGTRKDLEEAFHFG
AMGLVVPVVQKRPVEDAEAVFDEMAAGTIQGRMVLDFCHSH
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtcgttgtaaatccagaatctactggtgttgtcgttgtcgaaaaggaactt
cgtccactcgaagctggtgaggctttggtccaaattgagtactgtggtgtttgtcacact
gacctccacgttgccaatggtgattttggtaaggttcctggtcgcgttcttggtcacgaa
ggaatcggtattgttacagaaatcgcacctggtgttaccagtctaaaagttggtgaccgt
gtcagcgttgcttggttcttccaaggctgtggtatgtgtgaatattgtacaaccggtcgc
gaaactctctgccgtaccgtaaaaaatgcaggctactctgttgacggtggtatggctgaa
caatgtattgtaacagcagactatgcagtaaaagttccagaaggtcttgatccagctcaa
gcaagttctatcacttgtgctggcgttacttgctacaaagcgattaaagaagctcactta
gaaccaggtcaatggatcgctatctatggtgctggcggactcggaaaccttgctgtacaa
tacgctaaaaaagtcttcaacgctcatgttatcgcggtagacattaataatgataaattg
gaactcgccaaagaagttggtgcagatgtgacgatcaacggacttgaagtagaagatgtt
ccgggatatattaaagaaattactggtggcggtgtacactctactgttgtaacagctgtt
tccaaagtagccttcaaccaagctattgacagtgttcgtgctggtggctatgtggtggct
gtcggactcccatctgaatacatggacctcagtatcgtgaagactgtgctagacggtatc
aaagtggtcggctcactagttggtactcgtaaagatttagaagaggccttccacttcggt
gctatgggactagttgttccagtcgttcaaaaacgtccagtcgaagatgccgaagcagtc
tttgatgaaatggcagcaggaactatccaaggtcgcatggttttagacttctgccactca
cactaa

DBGET integrated database retrieval system