KEGG   Streptococcus suis D12 (serotype 9): SSUD12_0647Help
Entry
SSUD12_0647       CDS       T02021                                 

Definition
(GenBank) Homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
ssk  Streptococcus suis D12 (serotype 9)
Pathway
ssk00270  Cysteine and methionine metabolism
ssk00920  Sulfur metabolism
ssk01100  Metabolic pathways
ssk01110  Biosynthesis of secondary metabolites
ssk01130  Biosynthesis of antibiotics
ssk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssk00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    SSUD12_0647
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SSUD12_0647
Enzymes [BR:ssk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     SSUD12_0647
    2.3.1.46  homoserine O-succinyltransferase
     SSUD12_0647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: AER18968
UniProt: G7SDP4
Position
660888..661829
Genome map
AA seq 313 aa AA seqDB search
MPIKIEKSLPAVEILRKENIFVMDSDRASHQDIRPIKILILNLMPQKIVTETQLLRLLAN
TPLQLEVEFLYMASHESKNTHSDHLKQFYKTFEQVRDSYFDGLIVTGAPVENLPFEEVDY
WQELTQVFDWSKTHVYSTLHICWGAQAGLYARYGVPKHSMSRKLSGVYCQEVTNPTSPLM
RGFDDEFRSPHSRYTEVREADIAHLSGLTILSQGPEVGLSILASKDLREIYSFGHLEYDR
DTLAKEYQRDCIAGKNPHLPENYFKEDDPTSKPSLSWNLPAAQFFTNWVNYAVYQETPYD
WHIFEQSAQSASL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgccaattaaaattgaaaaatcattaccagcagttgaaattttgagaaaagagaatatt
tttgtgatggatagcgaccgagctagtcatcaggacattcgtcctatcaaaatccttatt
ctcaatctcatgccacagaagatcgtgacggagactcagttgctccgtcttttggctaac
actcctttacagctagaggttgaatttctctacatggctagtcacgagtccaaaaataca
cactcggaccatttgaagcagttttataagacttttgagcaggtcagggatagctatttt
gatgggctcatcgtgacaggagcaccagttgaaaacttaccttttgaggaagttgattac
tggcaagaacttacccaagtttttgattggtcaaaaacacatgtttattcaacattgcac
atttgttggggtgcacaggcaggtttgtatgcacgctatggtgtacccaaacacagtatg
tctcgaaaactatcaggggtatactgtcaagaagtgactaatccaactagccctcttatg
cgtgggtttgacgatgaatttcgttcaccacactcccgttatacggaagtaagagaagca
gatattgcccatctgagtgggttgacgattttatcacaaggtccagaagttggcctatcc
attttagccagcaaggatttaagagaaatttatagttttggacatttagagtatgatagg
gataccctagctaaggaataccaacgtgattgtatagctggaaaaaatccccatttaccg
gaaaattatttcaaagaagatgaccctacaagcaaaccatctctctcttggaatttacca
gcagcacaattctttaccaactgggtgaattacgctgtctatcaagaaactccatacgac
tggcatatctttgaacaatcagcccagtcagctagtctttaa

DBGET integrated database retrieval system