KEGG   Streptococcus suis D12 (serotype 9): SSUD12_0703Help
Entry
SSUD12_0703       CDS       T02021                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ssk  Streptococcus suis D12 (serotype 9)
Pathway
ssk00450  Selenocompound metabolism
ssk00970  Aminoacyl-tRNA biosynthesis
ssk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SSUD12_0703 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SSUD12_0703 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ssk01007]
    SSUD12_0703 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ssk03016]
    SSUD12_0703 (metG)
Enzymes [BR:ssk01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SSUD12_0703 (metG)
Amino acid related enzymes [BR:ssk01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SSUD12_0703 (metG)
Transfer RNA biogenesis [BR:ssk03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SSUD12_0703 (metG)
 Prokaryotic type
   Other AARSs
    SSUD12_0703 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AER19022
UniProt: G7SDU8
Position
717778..719781
Genome map
AA seq 667 aa AA seqDB search
MTKTPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFYLTGLDEHGQKIEEK
AKEAGLTPQAYVDGMAVGVKELWNLLDISYDKFIRTTDDYHEEVVAAVFEKLLAQDDIYL
GEYSGWYSVSDEEFFTESQLEEVFRDENGKVTGGIAPSGHEVAWVSEESYFLRLSKYQDK
LVEFFNAHPDFIQPDGRLNEIMKNFIEPGLEDLAVSRTSFTWGVPVPSNPKHVVYVWIDA
LLNYATALGYGQEERVNYDKFWNGTVYHMVGKDILRFHSIYWPIMLMMLDMKLPDRLVAH
GWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYE
LANDLGNLLNRTVAMINKYFGGQVPTFVANVTDFDADLAAVVAENLASYHKYMEAVDYPR
ALEAVWNIISRTNKYIDETAPWVLAKEEADRDKLAAVMAHLTAGLRVVAHLIQPFMMTTS
NAIMEQLGLGTAFDLENLDFAGLPAGLTVVAKGTPIFPRLDMEEEIAYIQAQMGGSSAIS
QEEEKEWNPADVELKNEKAAIKFEDFDKVEIRVAEVKEVAKVEGSDKLLKFRLDAGDGQD
RQILSGIAKYYPNEQELVGKKVQIVANLKPRKMMGLLSQGMILSAEHGDNLTLLPVDPSV
PNGSQIG
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacaccgttttatatcaccacaccgatttattatccgtctggaaaacttcac
atcggttcagcctacacgaccattgcctgtgatgtcttggctcgctacaagcgtctcatg
ggccacgaggtcttctatctgacagggcttgatgagcatgggcagaagattgaggagaag
gcaaaagaagctggtttgacacctcaagcctacgttgacggcatggcggttggcgttaaa
gagctctggaacttgctcgacatctcgtacgacaagttcatccgcacaaccgacgattac
cacgaggaagtggtggcggctgtttttgaaaaattgctggcgcaggacgacatttacttg
ggagagtattctggttggtactccgtatcggacgaggaattcttcaccgagagccaatta
gaagaggtcttccgagatgaaaacggcaaggtaacaggcggtatcgctccgagcggccac
gaggttgcctgggtttcagaagaatcctacttccttcgcctcagcaagtatcaggataag
ttggtcgagttcttcaatgcccacccagactttatccagccagacggccgcctcaatgaa
atcatgaaaaacttcatcgagccaggcttggaagatttggccgtatcgcgtacttcattt
acctggggcgtgcctgtaccgtccaatccaaagcacgttgtctatgtctggattgatgcc
ctactcaactacgcaactgccttgggttatggtcaggaagaaagagtcaactacgacaag
ttctggaatggaacagtttaccacatggttggcaaggacattcttcgtttccactccatt
tactggccaatcatgctcatgatgttggatatgaagttgccagaccgcttggttgctcat
ggttggtttgtcatgaaagatggcaagatgtccaagtctaagggcaatgtggtctatcca
gaaatgctggttgagcgtttcggcttggatccactgcgttactacctcatgcgtagtctg
ccagttggctctgacggtacctttacaccagaagattatgttggtcgtattaattacgaa
ctggccaacgaccttggaaacttgctcaaccgaacggttgctatgattaacaagtatttc
ggcggtcaggtaccgacttttgttgccaacgtgacagattttgatgcggacttggcggca
gtagtggctgaaaacttagcaagctaccacaagtatatggaagctgttgactatccacga
gctttggaagctgtttggaatatcatctcccgtaccaacaagtacatcgacgaaactgca
ccttgggtcttggcaaaagaagaagcggaccgtgacaagttggcagcggtgatggctcac
ttgacagcaggtcttcgtgtggtggctcacctcattcagccattcatgatgaccacttca
aatgctattatggaacagcttggtttgggaacagcatttgaccttgaaaatcttgatttt
gcaggtcttccagcaggtttgaccgtagtcgcaaaaggcacgcctatcttcccacgtctg
gatatggaagaggaaatcgcctatatccaagcccaaatgggtggcagctctgctatttcc
caagaggaagaaaaagagtggaacccagctgacgtggaactcaaaaacgaaaaagctgcg
atcaagttcgaggacttcgacaaggtggaaatccgcgtggccgaagtcaaggaagtagcc
aaggtggagggctctgacaagttgctcaagttccgtctggacgctggtgatggccaagac
cgccaaatcctgtctggtatcgccaagtattatccaaatgagcaggagttggtcggtaag
aaagtccaaatcgttgctaatctcaagccacgtaagatgatgggcttgctcagccagggc
atgatcctctcagccgaacatggtgacaatttaaccctcttaccagtcgatccatctgtg
ccaaacggcagtcagattgggtaa

DBGET integrated database retrieval system