KEGG   Streptococcus suis D12 (serotype 9): SSUD12_0748Help
Entry
SSUD12_0748       CDS       T02021                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
ssk  Streptococcus suis D12 (serotype 9)
Pathway
ssk00030  Pentose phosphate pathway
ssk00480  Glutathione metabolism
ssk01100  Metabolic pathways
ssk01110  Biosynthesis of secondary metabolites
ssk01120  Microbial metabolism in diverse environments
ssk01130  Biosynthesis of antibiotics
ssk01200  Carbon metabolism
Module
ssk_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:ssk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SSUD12_0748 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SSUD12_0748 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssk04147]
    SSUD12_0748 (zwf)
Enzymes [BR:ssk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     SSUD12_0748 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     SSUD12_0748 (zwf)
Exosome [BR:ssk04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SSUD12_0748 (zwf)
  Exosomal proteins of colorectal cancer cells
   SSUD12_0748 (zwf)
  Exosomal proteins of bladder cancer cells
   SSUD12_0748 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AER19063
UniProt: G7SFJ4
Position
complement(764083..765570)
Genome map
AA seq 495 aa AA seqDB search
MSSHVLFTIFGASGDLAKRKLYPSLFRLYKAGHIKENFAVIGTARRPWTKEFFEQTVIES
LGDLPDTPRQAHEFASHFYYQSHDVNDTEHYVALRKLQDDLCEKYDTQHNKVFFLSMAPE
FFGTIAKHLKSEQIVDGQGFERLIIEKPFGTSLATASKLNDELAAAFNEDQIYRIDHYLG
KEMVQNIFAVRFANIIFEHIWNRDYIDNVQITFAEAIGVEDRGGYYDHSGALKDMVQNHA
LQVLSLLAMDKPASFKEEDVRAEKIKVFQHLRQPSDEDLKRNFIRGQYVAGSIDGKGYIS
YLDEPNIAEGSQTETFAGGVFFVDTDRFRDVPFFFRTGKRLTEKGTRVTITFKHAEDIFG
QPSEANVLTIFIQPTEGFMLSINGKEVGSHFALTPAKLNFRHNATALGNSPEAYEKLFFD
VLNGDSTNFSHWEEVKASWSLIDRIVDLWASNQVPLHTYPAGTMGPEAAFDLLENYGCKW
VWTPDVWYRERGLLK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcacatgtattgtttacaatttttggtgctagtggcgaccttgccaaacgcaaa
ctttacccatctttattccgcctctataaggctggacacatcaaagaaaactttgcagta
attggtacagctcgcagaccctggaccaaggaattttttgagcaaaccgtcattgaatca
ctaggtgatctgcctgacacaccacgtcaagctcatgaatttgctagtcatttctactac
caaagccacgatgtcaatgacacggaacattatgtagctcttcgtaaattgcaggacgac
ttgtgtgaaaaatacgatacccagcacaacaaggtcttcttcctctctatggcacctgaa
tttttcggaaccattgccaaacatctcaaatctgaacaaatcgttgatggacaaggtttt
gaacgcttgattattgaaaaacctttcggaactagccttgcaaccgcaagcaaactcaat
gatgaattggcagcagccttcaatgaagaccaaatctaccgtatcgatcattacctaggc
aaggaaatggtgcaaaatatctttgcggttcgctttgccaatatcatttttgagcatatt
tggaaccgcgattacattgataacgtccaaattacatttgctgaagcgattggtgttgag
gatcgtgggggctactacgatcattctggcgccttaaaagacatggtgcaaaaccatgcc
cttcaagttctttcacttctagcaatggataagccagccagcttcaaggaggaagatgtc
cgcgccgaaaagatcaaggtcttccaacaccttcgtcaaccttctgatgaggacctcaaa
cgcaacttcatccgtggtcaatatgtagcaggttccatcgacggaaaaggctacattagc
tacttggatgaaccaaatattgccgaaggttctcagacagaaacctttgcaggaggtgtc
ttcttcgttgatactgaccgtttccgtgatgtacctttcttcttccgtacaggtaaacgt
ctgacagaaaagggcacgcgcgtaaccatcaccttcaagcatgcggaagatatttttggt
cagccttctgaggccaatgtattgaccatcttcatccagccaacagaaggcttcatgctc
tctatcaacggtaaggaagttggttcccactttgctcttactcctgccaaactcaacttc
cgccacaatgcaactgctcttggaaattcacctgaagcctacgaaaaactatttttcgat
gtcctaaatggtgattctactaactttagccattgggaagaagtgaaagcaagctggagc
ttgattgaccgcattgttgatttgtgggcaagcaaccaagtcccactccacacctatcca
gctggaacgatgggacctgaggcagcatttgatttgctagaaaactacggttgcaagtgg
gtatggacgcctgatgtatggtatcgtgaacgtggcttattgaaatag

DBGET integrated database retrieval system