KEGG   Streptococcus suis D12 (serotype 9): SSUD12_1595Help
Entry
SSUD12_1595       CDS       T02021                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ssk  Streptococcus suis D12 (serotype 9)
Pathway
ssk00071  Fatty acid degradation
ssk00072  Synthesis and degradation of ketone bodies
ssk00280  Valine, leucine and isoleucine degradation
ssk00310  Lysine degradation
ssk00362  Benzoate degradation
ssk00380  Tryptophan metabolism
ssk00620  Pyruvate metabolism
ssk00630  Glyoxylate and dicarboxylate metabolism
ssk00640  Propanoate metabolism
ssk00650  Butanoate metabolism
ssk00900  Terpenoid backbone biosynthesis
ssk01100  Metabolic pathways
ssk01110  Biosynthesis of secondary metabolites
ssk01120  Microbial metabolism in diverse environments
ssk01130  Biosynthesis of antibiotics
ssk01200  Carbon metabolism
ssk01212  Fatty acid metabolism
ssk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ssk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SSUD12_1595
   00630 Glyoxylate and dicarboxylate metabolism
    SSUD12_1595
   00640 Propanoate metabolism
    SSUD12_1595
   00650 Butanoate metabolism
    SSUD12_1595
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SSUD12_1595
   00072 Synthesis and degradation of ketone bodies
    SSUD12_1595
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SSUD12_1595
   00310 Lysine degradation
    SSUD12_1595
   00380 Tryptophan metabolism
    SSUD12_1595
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SSUD12_1595
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SSUD12_1595
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SSUD12_1595
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssk04147]
    SSUD12_1595
Enzymes [BR:ssk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SSUD12_1595
Exosome [BR:ssk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSUD12_1595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FKBP_N
Motif
Other DBs
NCBI-ProteinID: AER19869
UniProt: G7SEG2
Position
1595393..1596577
Genome map
AA seq 394 aa AA seqDB search
MKKVAIVSAYRSAIGSFGGSLKDIEIADLGAQVLETALANKNIPADSVDEVIFGNVLSAG
QGQNIARQIAIRAGIPQTASAYAVNKVCGSGLKSVLLAAQSIMLGDNDVVVAGGIEIMSQ
APYLSKTSRFGSKFGHITLEDSMLTDGLTDAFNDYHMGITAENVAEHYQVSRAEQDAFTY
SSQEKAAKAIAEGRFVDEIVPIRLKNRKGETIFATDEYPRLTPIEKLATLRPSFKKDGTV
TAANASGINDGCAVSVLMSDEKASELNIQPLAYIEAYATSGLDPALMGLGPITASQKALQ
KLNKTVEDIDLFELNEAFAAQSIPVVKQLGIDPAKVNVNGGAIALGHPIGASGSRILVTL
IHELIKQEKELGLCSLCIGGGQGISLIVSNAQTS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagctatcgtgtctgcctatcgttctgccatcggcagtttcggaggtagt
ctgaaagatattgaaattgctgatttaggggcgcaagtcctcgaaacagccttagctaat
aaaaacatccctgcagacagcgttgatgaagttatcttcggaaatgttctttcagcagga
caaggacaaaatattgcacgtcaaattgctattcgtgcaggcattcctcagacagcctct
gcctatgcagtcaataaagtctgtggttccggtcttaaatcagtcctcctggctgcccag
tcaatcatgctaggtgacaatgatgtagttgtggctggaggcattgaaatcatgagccag
gcaccttatctatccaaaactagccggtttggtagtaaatttggtcatattactctagaa
gattctatgctgacagacggtctaacagatgccttcaacgactatcacatgggcattact
gcagaaaatgttgctgaacactatcaagtcagtcgcgcagagcaagatgcttttacatac
agtagccaagagaaggctgcgaaagctattgctgagggaagatttgttgacgaaattgtt
cctattagattaaaaaatcggaaaggcgaaactatttttgccacagatgagtaccctcgt
ctgacgccaattgaaaaattggcaacacttcggccatcttttaaaaaggatggaaccgtc
accgcagccaatgcttctggcatcaacgacggctgtgctgtctcggtactcatgtctgat
gaaaaagccagtgagctaaatatccagccactcgcctatattgaggcctatgcaacaagc
ggtttagatcccgcattgatggggcttggacctattactgctagccaaaaagcgctacaa
aaactgaataaaacagtcgaggatatcgatctattcgaactcaatgaagcatttgcagcc
caatcaattccagttgtcaaacaactcggcattgatcctgcaaaagtcaatgtcaatggt
ggtgctatcgcccttggacatccaatcggagctagtggtagtcgaatcctagtcactctg
attcacgaattaatcaagcaagaaaaagagcttggtctttgctcactttgtatcggaggc
ggtcaaggcatctccctaatcgtttccaatgcgcaaacaagttaa

DBGET integrated database retrieval system