KEGG   Sclerotinia sclerotiorum: SS1G_00106Help
Entry
SS1G_00106        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K00365  urate oxidase [EC:1.7.3.3]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00230  Purine metabolism
ssl00232  Caffeine metabolism
ssl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SS1G_00106
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    SS1G_00106
Enzymes [BR:ssl01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     SS1G_00106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Uricase Gmad1
Motif
Other DBs
NCBI-GeneID: 5494480
NCBI-ProteinID: XP_001598020
UniProt: A7E484 A0A1D9PZR2
Position
Unknown
AA seq 302 aa AA seqDB search
MSSISSARYGKDNVRVYKVERDEQTGTQTVTEMTVCVLLEGAIDVSYTKADNSVVVATDS
MKNTVYIKAKEHPVTPPELFASILGTHFIDTYPHLTAANIKIITHRWTRMTIDGKPHPHS
FYRDGNETRNVEAVIKRGKGIDIRSGIVGLLVLKSTGSQFHGFVRDEYTTLPEVWDRILS
TDVDCGWAWKTFAGLDAVKEAIPKFDKAFDDARNITMKTFAEENSPSVQNTMYKMCNSIL
ETVPEVEAVDYSLPNKHYFEVDLSWHKGLKNTGKDAEVYAPQSGPNGLINVTVTRSPASP
KL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaatatcttcagcacgatatggcaaggataatgtccgcgtctataaggtagag
agagatgagcaaaccggaactcaaacagtcacagaaatgactgtttgtgtattactggaa
ggtgctatcgatgtatcatacacaaaagccgacaacagtgttgtggttgcaaccgattcc
atgaagaatacagtctatatcaaagccaaggaacatccagttactccacctgagcttttt
gctagcattcttggaactcactttatcgatacctaccctcatcttaccgcagccaacatc
aaaatcatcactcacagatggacacgaatgactattgatggcaaaccgcacccgcattca
ttctacagggatggaaacgaaacacgaaatgttgaagctgttatcaagagaggaaagggc
atcgatatccgtagtggaattgttgggcttttagttttaaagagtactggttcgcaattc
cacggatttgttagagacgagtatactacgctccccgaggtttgggatagaattttgtcg
actgatgttgactgtggctgggcttggaaaacattcgctggattggacgctgttaaagag
gccattcccaaatttgataaagcatttgatgatgctagaaatatcaccatgaagacattc
gctgaggagaacagtccatctgtacaaaacactatgtacaagatgtgcaattctatttta
gagactgtcccagaagtcgaggctgtggattattctttacccaacaagcattatttcgaa
gtcgatctcagctggcataagggtctcaagaacaccggcaaggatgcagaagtttatgct
cctcaatccggaccaaatggacttatcaatgtcaccgtcaccagatcccccgcctcgcca
aaactatag

DBGET integrated database retrieval system