KEGG   Sclerotinia sclerotiorum: SS1G_01155Help
Entry
SS1G_01155        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
ssl  Sclerotinia sclerotiorum
Brite
KEGG Orthology (KO) [BR:ssl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ssl01002]
    SS1G_01155
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     SS1G_01155
Peptidases [BR:ssl01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   SS1G_01155
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49 2C_adapt
Motif
Other DBs
NCBI-GeneID: 5493995
NCBI-ProteinID: XP_001596962
UniProt: A7E778 A0A1D9PUM9
Position
Unknown
AA seq 707 aa AA seqDB search
MNTQELKNFLADTPPSIVQLEIKKHFEALSDKEKRYAHYISRASMNGTRITLRQVSPESE
DIYDFIIELHKSINGDWGSAQKKAGISDEDLKFFLEYCAQFLGNCGNYKSFGDSKIIPRC
DEKVFDALAALSPKAKQHYEATKGAIFPTQNSGLMHLGFSDDGHLTNYYPDSTNITKSDI
VAVGEFLEQKGLLVENTRLRKTPEGSFELLLASAVTSIPPEGSDIGNETDFVIEKEPLEG
TKLKLIFGDYSKELALVAEDCKKAAENAANDTQKDMYEAYAKSFETGSSHVFKDSQRYWI
RDKGPSVESNIGFIETLRDPQGVRAEFQGFVAMVNAERTRAFGGLVNAAESLIPKLPWGA
EFEKDKFLSPDFTSLEVLTFAGSGIPAGINIPNYDDIRQTEGFKNVSLGNVLSAKAPNEK
IPFIKDEDLEVFSKYRDAAFEVQVGVHELLGHGTGKLLQETKPGVYNFDIKNPPTNPLTG
KPITTWYKPGQTWGSVFGSVASSYEECRAEAIAMALGCDFEVLKIFGYGDGTPDMNSEAG
DVLYASWLSMARMGICSLELWDPRSTKWNQAHSQARFSILQCFLSAPESFCTLTHSKPDL
SDLTISLKRHLIPTIGRQAVESYLQKLHIYKSIADVENGVKLYNKMCFVDLDYWGKNVRD
QVLANKQPRKIFVQANTVLDEKSGNVELKEYEASCEGMIKSFVERAV
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgaatactcaggaactcaaaaacttccttgcggatacacctcctagtatcgtgcagctt
gaaatcaagaagcatttcgaggcgctttctgataaagaaaaacgttacgctcattatatt
agcagagcatctatgaatggaactcgtatcacattgagacaagtttccccagaatctgaa
gatatctatgatttcattattgaacttcataaatccatcaatggtgactggggttctgct
caaaaaaaagccggcatcagtgacgaagatctgaaatttttcttagagtactgcgctcag
ttccttggtaactgcggaaattacaagtcttttggtgactccaagattattccaagatgt
gacgagaaagtcttcgatgctttagctgcgctttccccaaaggcaaagcaacattatgaa
gctactaaaggagctatttttccaactcaaaattctggattaatgcatctcggattttcc
gatgatggacatttgaccaattactatcctgattcaaccaacatcaccaaatctgacatc
gttgcagttggtgaatttttggaacaaaaggggttgctagtggaaaacacaagattgaga
aagactccggaaggatcattcgaacttttgcttgcctcggctgttacgagtattcctcct
gaaggcagtgatatcggcaatgaaaccgatttcgtgattgaaaaggaaccgttagagggc
actaaattgaaactcatctttggtgattactcgaaagagttggctttagttgctgaggat
tgcaaaaaagctgccgagaatgccgccaatgatacgcagaaggatatgtatgaggcatat
gccaaatcatttgaaacaggttcatcacacgtattcaaagactcacaaagatattggatt
agagataagggtccttcggttgaatctaacattgggtttattgaaactttgagagatcct
cagggtgtgagagctgaattccaaggatttgttgccatggtaaatgctgaacgcacacgt
gcctttggtggtcttgtcaatgcagctgaaagcctcattcctaaattaccttggggtgca
gaattcgagaaggataagtttttgagtccagatttcacaagtctagaagttttgaccttt
gctggttctggaattcccgcaggtataaacattccaaattatgacgacatcagacaaact
gaaggctttaagaatgtctcattgggaaatgtactatcagccaaagctcccaatgagaag
attcctttcattaaagatgaagatcttgaagtattctccaaatatcgcgatgcagccttc
gaggtacaagtaggagttcacgagcttctgggtcatggaactggtaaactactccaagaa
acgaaaccaggagtttacaattttgatatcaaaaatcctcccaccaaccctctcaccggg
aagccaatcactacttggtataagcctggacaaacatggggatctgtgtttggcagtgtg
gcatcaagttatgaagaatgtagagctgaggctatcgctatggctctcggttgcgatttc
gaggttcttaagattttcggatatggtgatgggacacctgatatgaatagtgaagctgga
gacgttttatatgcatcttggttatctatggctagaatgggtatttgctccttagaactg
tgggatccccgctccactaaatggaaccaagcccattctcaagcgcgcttttctatcctc
caatgtttcctctcagccccagaatccttctgtaccctcactcacagcaaacccgacctc
tccgacctaaccatctccctcaaacgccacctcatccccaccatcggtcgtcaagccgtc
gaatcctatctccaaaaactacacatctataaatccatcgcagatgtcgagaacggtgtg
aaactatacaacaaaatgtgtttcgtagatttagattattggggtaagaatgttagagat
caggtgttggcgaacaaacaaccgaggaagattttcgtgcaggcgaatacggtactggat
gagaagagtggaaatgtggaattgaaagagtatgaggcgagttgtgaggggatgattaaa
agttttgtggagagggctgtttag

DBGET integrated database retrieval system