KEGG   Sclerotinia sclerotiorum: SS1G_02725Help
Entry
SS1G_02725        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K00213  7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00100  Steroid biosynthesis
ssl01100  Metabolic pathways
ssl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    SS1G_02725
Enzymes [BR:ssl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     SS1G_02725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERG4_ERG24 DUF1295
Motif
Other DBs
NCBI-GeneID: 5492215
NCBI-ProteinID: XP_001596505
UniProt: A7EBN9
Position
Unknown
AA seq 388 aa AA seqDB search
MAMMGPVNFLWQHAPRGNMRTNVGYGAWLLFQAILYQFLPTKLSSGQLTPAGYLLKYRTN
GLSAWIVTHALFLISSCCGLLDPAILAKHWQALLISVNVYGFLLSGFAYLKAHLSPTHEG
DRKFSGSILYDLYMGIELNPRFGKHFDFKLFHNGRPGIIAWTLIDMSFIAYQYQIHGYIT
NSILLSTFLHTLYVVDFFINEDWYLRTIDICHDHFGFYLAWGSMVWLPSMYTLQTQYLSI
NPNSLSPFAAMTIFALGVSGYVLFRSVNHQKDLARRTKGKCQLWGAPADVLRVTYRTKDG
KEHESILLCSGWWGLARHVNYLGDLILSYSMCAACGINNLLPWTYAIFMTILLIHRCWRD
EERCSKKYGKGWETYCQKVKWVIVPGIY
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgatgggtcctgtcaatttcttatggcaacatgcgccacgaggaaatatgaga
acgaatgttggttatggtgcttggttgttattccaagccattctttatcaatttttacct
acaaaattgagttcaggtcaacttactccagccggatatcttctcaaatatcgtacgaat
ggtctttcagcttggattgtcactcatgctttgtttctcatttcgtcatgctgtggactt
ttagatccggcaatcttggcaaagcattggcaagcattattgatttcggtcaatgtttat
ggatttttgctatctggatttgcttacttgaaagctcatttgagtccaactcatgaaggc
gatcgaaaattcagtggatctattttgtacgatttatatatgggaattgaattgaatcct
agattcggaaagcactttgacttcaaattgtttcacaatggtcgacctgggataattgct
tggactctcattgacatgtccttcattgcataccaataccaaatccatggatatatcacc
aattcaatccttctgagcacttttctccatactttgtacgttgtggatttcttcatcaat
gaagattggtaccttcgtaccattgatatttgtcatgatcactttggtttctaccttgcc
tggggatctatggtgtggctaccttctatgtatacccttcaaactcaatatctctcaata
aatcctaactccctatcaccttttgccgccatgacgatatttgccttaggcgttagtggc
tacgttctcttccgcagcgtcaaccaccaaaaagatctcgctcgtcgcactaaaggaaag
tgtcaactctggggtgctccagctgatgttttacgcgttacatatcgaaccaaagatgga
aaggaacacgaaagtattcttctttgctccggttggtggggtttggctagacatgtcaac
tatctgggtgatcttatcctttcatattccatgtgtgcggcttgtggtatcaataattta
ctaccatggacttatgcaattttcatgacgatattgttgattcatcgttgctggcgagat
gaggaaaggtgttcgaagaaatatggcaaaggttgggaaacttattgtcagaaagttaag
tgggttattgtgcctggtatctattga

DBGET integrated database retrieval system