KEGG   Sclerotinia sclerotiorum: SS1G_04551Help
Entry
SS1G_04551        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00040  Pentose and glucuronate interconversions
ssl01100  Metabolic pathways
Module
ssl_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SS1G_04551
Enzymes [BR:ssl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     SS1G_04551
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pectinesterase
Motif
Other DBs
NCBI-GeneID: 5490879
NCBI-ProteinID: XP_001594743
UniProt: A7EGV9 A0A1D9PWZ2
Position
Unknown
AA seq 332 aa AA seqDB search
MATFKYLSNFLIAISFFVLAIDATPLVHKRAGRTSAPAGCLTVRGSGTHSGEYSTVGAAL
SALGSSKSAACIFIYSGTYNEQLTIKYGGNLTVYGYTTDIGTYKSNTVKITHGINSTTIG
LDASSTANIVSANFKAYNVDFANTYGAGVQAVAVTANGDQQGYYGCSFTGYQDTLYAKAG
KQYYSNCYIEGAVDYIFGDAAAWFGECTIASNGGGAITASSRTLSSDSGWYVIDSSTITQ
ADGYSLTGKVYLGRPWRALARVIFQNSVLTAVVNPAGWTTLAADATPIFMEYANTGAGSS
TSARVYETAATGTVNKNTLWGNTWASWVDTSY
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggcaacttttaaatatctcagcaattttctaattgccatttccttctttgtccttgcc
atagatgcaacccctctagtgcacaagagagctggtcgaaccagcgctccagctgggtgt
ctaactgttagaggaagcggtactcactccggcgaatatagcacagttggagctgcattg
agtgcccttggatcttcgaaatcagccgcatgtattttcatatatagtggaacatacaac
gagcaacttacgattaaatatggcgggaacctcaccgtctatggatacactactgatatt
ggaacatataagagtaacacagtaaagatcactcatggtatcaactccactactataggc
ttggatgctagttccacggcgaacatcgtgagcgcaaatttcaaggcgtacaatgttgac
tttgcaaatacttatggggccggtgttcaggccgtggccgtaaccgccaatggagatcag
caaggttattatgggtgttcatttaccggctaccaagatactttatatgccaaagcaggc
aagcaatactactccaattgttacattgaaggtgctgttgattatatattcggtgatgct
gcagcttggtttggcgaatgtacaattgcttcgaatggaggaggtgctatcacggcgagc
tcaagaacacttagcagtgacagcggctggtatgtcatcgacagctctactataacccaa
gcagatggttatagcctgacaggaaaagtctatctcggacgaccatggagagccctcgct
cgtgtaattttccaaaattcagtcttgaccgcagtggtaaatccagctggttggactact
cttgctgctgatgctacaccgatatttatggaatatgccaatacgggagctggttcaagc
acatctgctagggtttatgaaactgctgctacgggtacggttaataagaacacattgtgg
ggaaatacttgggcttcttgggttgatacttcgtattaa

DBGET integrated database retrieval system