KEGG   Sclerotinia sclerotiorum: SS1G_04900Help
Entry
SS1G_04900        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00630  Glyoxylate and dicarboxylate metabolism
ssl01100  Metabolic pathways
ssl01110  Biosynthesis of secondary metabolites
ssl01200  Carbon metabolism
Module
ssl_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ssl00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SS1G_04900
Enzymes [BR:ssl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SS1G_04900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICL PEP_mutase DUF2458
Motif
Other DBs
NCBI-GeneID: 5489925
NCBI-ProteinID: XP_001593473
UniProt: A7EHV8
Position
Unknown
AA seq 550 aa AA seqDB search
MFRKIASVAPRKAFSARAPIITIRHISTTSCRMSALKALNDPISRPLASDSFQLVPESQK
AGAAEDELYEQQIKEVETWWNSPRYVGIKRPYSAADVVSKRGSQQQSYPSSVMARKLFNL
IKEREAKGEPIHTMGAIDPVQMTQQAANQEVLYISGWACSSVLTSTNEVSPDFGDYPYNT
VPNQVQRLSKAQSMHDRKQWDARRKLSKEDRAKTPYTDYLRPIIADGDTGHGGLSAVLKL
AKLFAENGAAAVHFEDQMHGGKKCGHLAGKVLVPVGEHINRLVAARFQWDVMGSENLVIA
RTDSESGKLLSSAIDVRDHEFIKGVAEDGIEPLAETLQAMDLSGATGAEIDIFEAEWVKK
TKLMTCDEAVVKQFKDQGFYHYKAGMEAATKRAIQYAPYADLLWVETGDPNVKNAAQFSA
EIRAKYPGKGLVYNLSPSFNWMGHGFSDETLKSFIWDIAKHGFVLQLISLAGLHSTATVT
NELSKAFKDDGMLAYVNLIQRREKDLGVDVLTHQKWSGASYIDGILGAIQSGSSSSKSMG
DGNTEGQFGV
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgcaaaattgcttctgtagcgccccgcaaagctttctctgccagagctccaatc
attaccattcgacatatatctaccacaagttgtaggatgtctgcattgaaagctctcaat
gacccaatatcgagaccattggcatcggattcatttcagcttgtaccagaatcgcagaag
gccggagccgccgaggatgaattatacgaacaacagataaaggaggtggaaacatggtgg
aatagtccaagatatgtaggaatcaagagaccatattctgcggcagatgtggtatcgaaa
cgaggaagccaacaacaatcatacccaagttcagttatggctaggaagttattcaattta
ataaaggagagggaggcaaagggggagccaatacatacaatgggtgctattgatcctgta
caaatgactcaacaagctgcgaatcaggaagtcttgtacatatctggctgggcttgttcc
tctgtgctcacaagcacaaatgaagtatccccggatttcggcgattatccttacaacaca
gtaccaaatcaagtccaaagactgtcaaaggcgcaatcaatgcatgatcgaaaacaatgg
gatgcgcggaggaaattgagtaaggaagacagggcaaagacaccgtataccgactatcta
aggcccattatcgcggatggagacacggggcacggaggactttctgctgtattgaagctt
gccaaactatttgcagagaacggcgctgcagctgtgcactttgaggatcaaatgcatggt
gggaaaaaatgcggacatcttgctggcaaggttcttgtgcccgtgggtgagcacatcaat
cgcttggtggctgctagatttcaatgggatgttatgggatcggaaaatctagtcatagct
cgaacagactccgagagcggcaaacttcttagtagtgccatcgatgtccgggatcatgag
tttattaaaggcgtcgcagaagacggtatcgaacctttagcagagaccctgcaagccatg
gatttgtctggagctacaggcgccgaaattgatatatttgaagcagagtgggttaagaag
acaaaactcatgacatgtgatgaagctgttgtaaagcaattcaaggatcaaggcttttac
cattacaaggctggaatggaagccgccaccaaacgagctattcagtatgcaccatacgct
gaccttctatgggtggaaacgggagatccaaacgttaagaacgccgcacaattttcggcc
gaaattcgagccaaatacccaggtaaaggacttgtctacaatctctctccttcatttaac
tggatgggtcatggtttcagtgacgaaaccttgaaatccttcatttgggatattgcaaaa
catggattcgttctacaattgatttcacttgccgggcttcattctactgcaactgtcacc
aatgaactatcaaaggcattcaaagatgatggtatgctagcatacgtcaaccttatccag
agaagggagaaggatctaggagtggatgtattgacgcatcagaaatggagcggtgcatca
tacatcgatggtatactaggcgctattcaaagtggtagtagcagtagtaagagtatgggc
gacggcaatactgaaggacaatttggagtgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system